SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2T7Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2T7Z6
Domain Number 1 Region: 158-257
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.09e-31
Family Ras-binding domain, RBD 0.0039
Further Details:      
 
Domain Number 2 Region: 291-401
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-16
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2T7Z6
Sequence length 658
Comment (tr|H2T7Z6|H2T7Z6_TAKRU) Ras association (RalGDS/AF-6) and pleckstrin homology domains 1b {ECO:0000313|Ensembl:ENSTRUP00000020786} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
QDLDKMFGAWLGELDKLTQSLDDGRPQKALQKPPLRQETNMANFSYRFSMYNINEALNQG
DTVDLDALMADLCSIEQELNTISKPNSTSRSHNKGQQRAPGGHSASTKHTGASGGGSSGG
STNSSTRASPANTPVWKPFVEEQAAKLKAERIRVALEKIKEAQVKKLVIRVHMSDESSKT
MMVDERQTVRQVLDSLLDKSHCGYSPDWSLVETITELQMERIFEDHENLVENLLNWTRDS
HNKLMFTERIEKYALFKNPQNYLLGRKETSEMADRNKEALLEECFCGGSVSVPEIEGILW
LKEDGKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQLDHVNVYYGQDYRSKYKAPT
DYCLALKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKKYGKQLYGNYHEAMKRTEAA
YDWSSLSTSSIRSGSSSQQPPPQPQSQPVQKHPPQPHIYNHVPLQQPQTSPPPPPPPPPP
PPPPPPAARTNVPPPPPPPPPPSMPTPGSAMGFEESPPPAPTPTPPPPPPPPPPPPPPPP
QQQQFHIPSQFPPPPAPAKMFTSGFGPHTTPKPVSPVSPFPPAPPPATLGGLTPPPPPPP
PPPAPLKKQFSLQAGHTSIQPPPTLPKQHSLSKQMTSTGGPQTMSLVKQLASQFPGAP
Download sequence
Identical sequences H2T7Z6
ENSTRUP00000020786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]