SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2T871 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2T871
Domain Number 1 Region: 326-533
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.34e-27
Family Laminin G-like module 0.0068
Further Details:      
 
Domain Number 2 Region: 572-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000561
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 3 Region: 55-146
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000657
Family Cadherin 0.011
Further Details:      
 
Domain Number 4 Region: 610-650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 5 Region: 535-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000375
Family EGF-type module 0.016
Further Details:      
 
Domain Number 6 Region: 3-51
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000614
Family Cadherin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2T871
Sequence length 1047
Comment (tr|H2T871|H2T871_TAKRU) FAT atypical cadherin 3a {ECO:0000313|Ensembl:ENSTRUP00000020861} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=fat3 OC=Takifugu.
Sequence
KEFVLERDGTLVANQVFRRDLATEYVLQIQVTDSGRPSLSSSSVLTVRVIEESLHRPVAS
PLEIHIVTMEDEFPGGVIGQLHATDTDPYDALTFGHASAAQRGLFKISPRDGKIIALGGL
DAGRYLLNASVSDGRFVVSAPVSIHVVQATPEMLQEAVTVRFESVTPHDFVEFHLKSVLK
VLHQIASSQRQDSVRLLSLQPVGGTQQLDMLVAVEAAKEEYYKAAYVTQKLSASRRQLEE
LLRVSAILDKNCSGLECHGAQCEQNIVLNSHNLTTYSAQRTSFVSPHFHRSSRCTCSDAS
CAVVSEQCRDHPCPDDMQCVSNTATRGHYACQCAPGKHGQCTGHSSLSFSGNSYIKYRLY
DLLQSEMKVSLRVRTLQSQGVIMFTKTEPCMVLKLAEGKLWFQLASDLGGGSSPGMMGIS
GSQINDGSWHTVTLELNRNFSSLTLDNRYAEGSRGPPFIHSLAAGITIYFGALVQSKSHD
LLDAQKDPQVLEGFQGCLDSVIINNNELPLHNKRSHYAEVVGLTEIKLGCVLYPDVCLQQ
PCQNGATCTSHPSGGFACSCGPQFTGAYCETEVTACVPSPCQNGGACKSIGNAFFCSCRR
GFKGLTCGEDINECDTAKPRSECENGGVCVNTHGSFYCNCTAGFVGQRCSLRGVFVPDMR
AGSAVINKEELIGIALVVFIIITLIVLFVAFRKTVFQKNYSRNNLSLVQDPATAALLNKA
NGIQFQFLNCTPGDPFNLYTETGLGPAMVGPPQVPVRPLPYTPCFQRDPRCTLEKSDRCV
VEHTEMSTFHPESPRSGSGTIKRGVVVCVPPSLSSVLSCQSDCESICKSTWDNDEDKTAD
TADEVICYSGSNKDSNSEVQSLNSYQSDSCDDNASIVTVIRLVNDAVDTIESEVSVLDHE
SIYNKAYHWDISDWVPSSKLSSFEEVPGYDARLGSGAAGSATCPGDTAHELESDYYLGGY
DIDSDCPSSHVEEFLSEDALPPPLPTDEDFPELYMPITSVSSDSTLSSGSNRCQNTRPHP
SQNLSPHQLPPEDAAQVGPGSSVSGAT
Download sequence
Identical sequences H2T871
ENSTRUP00000020861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]