SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2T941 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2T941
Domain Number 1 Region: 327-371,729-978
Classification Level Classification E-value
Superfamily RNI-like 2.35e-45
Family 28-residue LRR 0.022
Further Details:      
 
Domain Number 2 Region: 15-84
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000254
Family Caspase recruitment domain, CARD 0.0042
Further Details:      
 
Domain Number 3 Region: 114-187
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000141
Family Caspase recruitment domain, CARD 0.0083
Further Details:      
 
Domain Number 4 Region: 271-441
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000521
Family Nucleotide and nucleoside kinases 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2T941
Sequence length 985
Comment (tr|H2T941|H2T941_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000021181} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=nod2 OC=Takifugu.
Sequence
MRVQDLVLNQRTEILRVLCSSGSAEPVEHVTDILLSQGELTWEDYQSIHVSGRPLYTNAR
QLLDVVYLKGESSCGLFLEALKQVLPEEQPAGFSFPDHWWDPEVREECQNTFCQTLLTQR
PSLVSTLQHCVDGALEALLTSAHFTSADCEGIRLPLRTPSQQARCLLDHVRAKGEAAAKF
LLEYIQQGEESGSILNKKTQTVSREFLKFQKKLRSSLSAQSCFLSTYGGTSHMSLDDIYT
DGQLELAEACPDVHGPIGLKDITGEVGTINEEADTVLVSGEAGSGKSTLLQRLHLLWARE
AALLEYLLLFPFSCRRLNTELSELSFKELLFQHCCWPDRDQDEIFDFIQDHPHLILFTFD
GLDELKQSFSDEHRLCCPTQRAPVHVLLFNLIQGSLLKGVRKVVTSRPSAVTPVLKKNLC
KEVLLKGFSPSGIDCFVRKHHSDPTVAAKVLQSLHTNTTLLGLCHSPVLCWIVSCCHKEL
LGCGEGSPQTITDVYLTIVEHFFQHHSPLRSTGKISWHREYLDPVLRLGQLAFKGIVSTC
YIFSDKDLDPCAITKEDLSLGFLIQSKDLSVFRSKCYEFLHVTMQCFFAAVYVVVSKDLD
RSTIPKLFELKNLKETSLRTACFSACLLYQQDKDATAVETPNLQMTATFASGLLSQRHRS
LWLHCCPATAIDRKTRQVSKCLSKGMQKHFKSIPQPVAGEKKSMHAMPGFVWLIKCIYEM
QECSIAKDAMSKLEVDHLKLTYCNIGPVECTALAFVLQHLNNPVGLQLDNNTVGDVGVEQ
LLPCMHICHSLYLRNNNITDEGIHKLIAKSIQCDNFHKIALFNNRLTDACTQDFSLLLKT
KQDFISLRLGNNNITAEGAKQLAEGLRVNKSLKFLGLWGNSIGDAGAEALASALEGNTTL
VWLSHSLVGNGIGSAGACALSKVVKNNVSLEELWLTENCITRMGVECLIEALQHNANVKS
IWLRNNDLCLEEVEEMAQRESRLLF
Download sequence
Identical sequences H2T941
ENSTRUP00000021181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]