SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TG40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TG40
Domain Number 1 Region: 666-791,961-1103
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-25
Family p120GAP domain-like 0.043
Further Details:      
 
Domain Number 2 Region: 7-88
Classification Level Classification E-value
Superfamily Sema domain 0.0000000000085
Family Sema domain 0.015
Further Details:      
 
Domain Number 3 Region: 91-127
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000353
Family Plexin repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  H2TG40
Domain Number - Region: 291-367
Classification Level Classification E-value
Superfamily E set domains 0.00392
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.083
Further Details:      
 
Domain Number - Region: 380-437
Classification Level Classification E-value
Superfamily E set domains 0.00863
Family E-set domains of sugar-utilizing enzymes 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2TG40
Sequence length 1177
Comment (tr|H2TG40|H2TG40_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000023638} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=plxnc1 OC=Takifugu.
Sequence
MITSCTIRQKHMTSVLAVRQKAWVVFFIGTEDGQLIKLAVDKRYHAACPKVLYRANDDRP
VFPKIYLDQVDHKHLYMAFSNQVKRVPVSTCSSYTTLQDCWSAQDPYCVWCSSKNSCTYE
EACGGSAWLSIPEESQHKMVSYEVVKTTDEEKITITVLAQVTVNQRAASNFTCRFSTNSV
QLSCKTPLTFPQCTCTLPRGELPAEGLPVVVEITFGMTRLEEHINIFNCTNIRDPPASVA
WSPNGCTWANAGERNVNTQFSADPMNFAHFSLQESVCQKVESGLNSTGQGPEIFSVSPNV
VSFYGKNHAELSGRNLAGVTRVRIQANMDCKWQESPVWSNTGTSLTFRIPSAASKGAVQV
CVVLSDNSCHGDATITYQSLPSCSGITPKSSWVSGNRVITLTGSHLEFVDGVMHRGVPLD
VHPQINSSLQILTYHTHESFGAPSREVLLRVVNETLPCSNITYHPDPEFTSFTTVNIQGG
VRVTMQKKADKLEIQPEELSVWGIYEGKEHPCEMETTESTNDFIICEIQTPQTIAFSVYL
SQIKFGQKTVTLKSASWVPILLVLLLIPFIIVLVAIVYCNKQKKLTAQMNKRMEELELDV
RNDIRQGFVDLQTEKADLMENVGTIPFLDYKHFASRIFFPENDLLMKACIKDIGQDARQN
QLDKCCQGLSKLLQDQLFLTSMVHALEEQRSFTIKDKCALASLLTVALHNKLSYLTDVME
ALLKDLMQQNRGAQPKLLLRRTEFIVEKLLTNWMAICLYGFLRESVGQQLFLMVSALTQQ
IAKGPVDCVTEKALYTLSEDWLLWQAQDFSSLTLRFVFDLTVGNDGEVSEPLEVKALSCD
TVEQVKEKILSTFKAKFGFSYSTTFRDLCLEYEKNGSFVPLQEVDASSEVIGDVTMLNTL
KHYKVPDGATVKVLSALLICLHSDDENFSGKYFHLIDPDVDEDKRKNPERKKLKLKEVHL
TKLLSTKVALHSFVENLFRSIWGTPYTKAPHAIKYFFDFLDRQADAMRITEPDVLHIWKT
NSLPLRFWVNIIKNPQFMFDMEKTPNLDGCLSVIAQAFMDSFSLSETQLGKYAPTNKLLY
ARDIPIFKQEVKAYYKQVREQPPVTASEFKDFLQQESKKHENEFDDSVALRELYKFIRQY
FTEIKEKLDKNGAPSELVEQLHHVRNSFDGLQSCSWN
Download sequence
Identical sequences H2TG40
ENSTRUP00000023638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]