SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TG67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TG67
Domain Number 1 Region: 407-498
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 7.46e-40
Family Small-conductance potassium channel 0.00000342
Further Details:      
 
Domain Number 2 Region: 276-447
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-28
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Weak hits

Sequence:  H2TG67
Domain Number - Region: 483-534
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.0706
Family Coiled-coil dimerization domain from cortexillin I 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2TG67
Sequence length 587
Comment (tr|H2TG67|H2TG67_TAKRU) Potassium calcium-activated channel subfamily N member 2 {ECO:0000313|Ensembl:ENSTRUP00000023665} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=KCNN2 OC=Takifugu.
Sequence
SAGRRRPLWHHRHQQQQQQQQHRRGRQRGSLGSSHRDSNSYNEIAMSSCRYNGGVMRPLS
NLSSSRRNIHEFDSESQPLQPISAADASDALVSKPENNSTTLMPYASGDGGGGCGHSGGK
SGKKKNQNIGEKLGHRRALFEKRKRLSDYALIFGMFGIVVMVVETELSWGAYGKESLYSL
ALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHP
VPGNYTFTWTARLAYSYVPSKTDADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSI
GALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNQDINSNFLGA
MWLISITFLTIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHN
FMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKTDHAKVRKHQRKFLQAIHQLRSVKME
QRKLNDQANSLVDLAKTQNIMYDMVSDLNEREENMEKRIAALETKLEALLSNLQALPGLI
SQVISQQHRDFLEVQLQPYDKHSPERSQSASRRRSSSTAPPTSSDSS
Download sequence
Identical sequences H2TG67
ENSTRUP00000023665 ENSTRUP00000023665 31033.ENSTRUP00000023665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]