SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TK28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TK28
Domain Number 1 Region: 402-504
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 7.06e-29
Family FAD-dependent thiol oxidase 0.0031
Further Details:      
 
Domain Number 2 Region: 39-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 4e-21
Family PDI-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2TK28
Sequence length 735
Comment (tr|H2TK28|H2TK28_TAKRU) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
TSRCAGGTQTHRRRTRATTAVWLLTYLILPSATEAGLYSATDQIISLNAENVETVLVNST
AAIVAEFYASWCGHCVAFSPVYKSLARDIKEWKPAVDLAAVDCAATETRQLCFDYGIKGY
PTLKFFHAYSKEGSKGLSLKGFPRDVRGLRHRIIDQLEKHQEPWPPACPPLELISQAEID
RFFETNSVQHIALIFEDDKSYIGREVTLDLLQFENIAVRRVLSTEEGLVTKLGVTDFPSC
YLYYPSGNFTRLQVNIQARTFYSYALQRLPGVVRSGKPPPPATVESLTNRTDEPWRPFNR
SRVYMADLESTLDYSLRVELAAHSVFSGHALVSLKKYISVLVKYFPGRPMVMNLLKSLNS
WLQDQPGDEISYEALEKIIDNRAQSPNTTLPQGARWVGCQGSQPHYRGYPCGVWTLFHVL
SVQAKKDEGTDAKEVLSTMRGYVHHFFGCRLCAKHFEEMAQKSLSEVNTLSAAVLWLWKR
HNQVNNRLAGALSEDPKFPKIQWPSPEMCPSCHSVMENREHRWNQDRVLSFLLSYYSSQD
ILTDYLEDENQILAKQREKHASQAVEARNRAERKAREASDSLPLPSQPTVHSEEEEEEEE
EEVQDEAAAEEDRVKQRTLQRKEEPEPGPVFGLGMELDAGFGMVGLQPLEAELDQDTQQQ
TKQRPKRELVGRYLTEEEWSHKRQWMSALSIGFSRVDISLCVILYFLSCVCLLVMYLFFK
SRLRLRKDHSAESAA
Download sequence
Identical sequences H2TK28
ENSTRUP00000025032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]