SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TKD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TKD8
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-45
Family Calponin-homology domain, CH-domain 0.0000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2TKD8
Sequence length 298
Comment (tr|H2TKD8|H2TKD8_TAKRU) Calponin {ECO:0000256|RuleBase:RU361224} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101073139 OC=Takifugu.
Sequence
MTTHFRSGPAFGLSAEVKSKLAAKYDSQKEEELRLWIEDVTSKRIGDNFMDSLKDGVILC
ELINVLQPGSIKKINNPSQNWHQLENIGNFVRAITDYGLKPHDLFEANDLFENMNHTQVQ
STLIALAGMAKSKGFHSNYDIGVKYAEKQQRHFPPEKLREGRNIIGLQMGTNKLASQKGM
TSYGTRRHLYDAKMAMDNPMDQSTISLQMGTNKGASQAGMTAPGTRRHIFDRKLELENCD
STTISLQMGTNKVASQQGMTTYGLPRQVYDNKYCTNPNEAYYDNGSEVEFDSYNQYSD
Download sequence
Identical sequences H2TKD8
ENSTRUP00000025142 31033.ENSTRUP00000025142 ENSTRUP00000025142 XP_003966442.1.43653 XP_011604310.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]