SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TKN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TKN3
Domain Number 1 Region: 35-503
Classification Level Classification E-value
Superfamily Sema domain 6.93e-118
Family Sema domain 0.00000234
Further Details:      
 
Domain Number 2 Region: 1070-1341
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-77
Family Protein kinases, catalytic subunit 0.00000000635
Further Details:      
 
Domain Number 3 Region: 653-745
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000377
Family E-set domains of sugar-utilizing enzymes 0.066
Further Details:      
 
Domain Number 4 Region: 506-551
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000549
Family Plexin repeat 0.00089
Further Details:      
 
Domain Number 5 Region: 549-625
Classification Level Classification E-value
Superfamily E set domains 0.0000000000377
Family Other IPT/TIG domains 0.036
Further Details:      
 
Domain Number 6 Region: 745-847
Classification Level Classification E-value
Superfamily E set domains 0.000000187
Family Other IPT/TIG domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2TKN3
Sequence length 1381
Comment (tr|H2TKN3|H2TKN3_TAKRU) Macrophage stimulating 1 receptor a {ECO:0000313|Ensembl:ENSTRUP00000025237} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101071528 OC=Takifugu.
Sequence
IKRPSCISKLTFLLCASLNPCSEILTKNKTNLEVKYSLPHFQTSKPVQNIAVNWDSQQKE
IYIGCQNAIKAVSGTLEEMWEVKTGPVGSPDCETCKLCDVEADPEDPVDTDSEVLVLDPA
GILLPYLYVCGSTQHGICYFIDIESPEHAPQCLYKKQRNSPTRCPDCLASPLGTKVSIIE
DGSTTYFFVAAAVDDRVAQRYPRRSISVMRPLSTEDGFEMVTDGLTVLPSLRSTYKIDYI
HSFATKEYVYFLSLQRENPSNSNSPLQTRLGRLPISIREVWMYREVVLECHFNPKRRRRG
DFRGIVYNGLQAAHFGRAGKDLAEELRVDEQEDILYGVFAVVNELGETQRNSALCAFPLS
KVNHAIDEGVEACCRSVWVPNREMHSSNMYFKIKAQGSKSSEDKYTCRSKPTLVAQPHYR
LDLFNRKMRDVLFTTVLVTTTGNHTLGHFGTSDGRILQVILSLYRPIVFANYSLGDGEVS
RTAAVYSEDWLLFVVGNKMFKVPSLGPGCAHFRTCSMCLMAPRFMNCGWCSGVCSRQHQC
DMQWEKDSCAPVITEFSPKVAPVGGDTEVTLCGWEFQSPLRPAIINGKTHSIMVGSTVCI
VLPEKSSSEKLVCRIQEKNKPGQDLKIVLKVHEGEVEGRYSIEGTAQIQGFSFVEPSITD
IQPDYGPAFGGTTVTLTGRHLDSGFQRDVFFGEKQCRILSVSGGTDASSSIVCLPAVAED
VGSVPVKVLIDSFPVTATKMFFYKRNPVITLVEPQCSLHRQHSGSRLVIQGQNLDSAHKT
VVEYVSKDANLRPLQQVCNGSTNATHMECWAPALPEEMPDEKETGQIYIHMEEQLKVWSS
RFEYHGNVKVIPFENEDRVLLLKPGENEVSLHHRNLNTVSLCMKINMTVGGVDCNAEVLS
NELTCRIPKGLVIPTGGLPVKVSIGGEVYDVGTVGIDDSNAAVSIAVITLSIVGALVLGA
VMALAVMFHVRKKKKANIEHRLSTRLSLARSSAAADFSPTGDYRRDECLRFPPVTVDLSS
PTSGSGGMAFQGLLYAASSDHLSIPLLPRDNISMVSLNPDLLEEVKNVLIPADMLRIEDR
QVIGKGHFGTVYHGYLIDSNKQETHCAVKSLNRITDLKDVDHFLREGLIMKGFDHPNILS
LLGIMLPKEGLPLVVLPYMKHGDVRHFIRSEKRNPTVKDLIGFGLQVAKGMEYLAQKKFV
HRDLAARNCMLDETYTVKVADFGMARDIYDKEYYSIQDHKQVKLPVKWMAIESLQTQKFT
SKSDVWSYGILMWELLTRGASPYPDVDPYDITNYLLKGRRLPQPQFCPNTLYSIMLSCWD
PEPDFRPSFSSLASDVQHILLCLQGEHYISLKVNYVNLDQPRPYPSLTGSADEAEASDLD
S
Download sequence
Identical sequences H2TKN3
ENSTRUP00000025237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]