SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TM89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TM89
Domain Number 1 Region: 1327-1465
Classification Level Classification E-value
Superfamily PRC-barrel domain 3.06e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000141
Further Details:      
 
Domain Number 2 Region: 207-299
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000136
Family Calponin-homology domain, CH-domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2TM89
Sequence length 1470
Comment (tr|H2TM89|H2TM89_TAKRU) Calmodulin regulated spectrin-associated protein family, member 2a {ECO:0000313|Ensembl:ENSTRUP00000025795} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=camsap2 OC=Takifugu.
Sequence
YDFSRAKISCSLTWLVAKAYGTDCIPADLKEPFYTDQYDQEHLKPPVASLLLSADLYCRA
GSLILKRDAAKPLLGHDAVIQALAQRGLYVTDQDRMVTERDLRKRPLQMSAHLAMIDTLM
MAYTVETASAEKVMACIRQYSCGSTEEETPYDTEDVVTTWINTVNEYLKEIVTQEQRREA
QGAEPAGSPRARYRKEQASAQPVPWIPPVDNLLKDSTDGSALAVLLHFYCPQLLQLSDVC
LKENMTLADRLYNLQLIQEFCKDNLNDCCHFTLEDMLYASSTIKNNFLVFMAELFWWFEV
VKPSFVKPRLLSNEYADPSSVLKNIPVIPISKATKRSFMERPPSPERPRYSASKSKYLSC
RKYLNGKSVNTNLQCIYLLNFSVISSKCPVCRSDLNLETQVICMIFHSFIHLRFLNYYHC
STTCTHKIRNTVAGTQTDLGEIKRSTSMSFVEGNLGTWPKEKRFVTCRLCRSSALFGITL
LRQSNVMVPFRSGPYGVSFDIPFDKDSSTSVPLSSTRGMIRSVSTDDGSGFKVQHLPRGM
KRNLSFQPVNGTKVIGIAEEGCPDSLAGVEPESVYPNGQGSFVATTPSMEEALQIIHSPT
RPVVEGIQNGFFLHSQDHGAGGLEPVSESDSKEVLSTTDTTEVDTGIHIRTEDMLDEDSS
LKDCSVNMDLDMDSPSPCASSLSKSPSGLKMTCFAEQKLKKHTPDSGRCSSSSLKTTPEG
SDFGAPLSVSWAPTPEHSPVRQQAAPSPVQLPASDPAQAMATEMVQLRMRLEEKRKAIEA
QKKKVEAAFTRHRQKMGHSVFLNVVKRKGDGAASGEEARKSEGEGKAASPILKFGRSKAD
TPDGAEQSSPGCWTKSPGVGEESGQSHAQLTELDLTEYTRSIEKLNHSLAFLQAEMQRLS
QQQEVIMAMREQQHQQAWVIPPPHTNPSPQRHSRAGAVTRSSGPSSPVDSPLPSHRSPNS
IKRKSASFHSRNPRTARPSELKLAPYNRVLTAPQSVDSIPRLRRFSPCQPLACSFAYMEE
KPAPNPAPVATDGDRKAASTQAQDTDCQPKTTGTEKDQDLDLKPTMESSFPEVLSHLVTE
TFTVAPTEMPPQPEASGQAKSSLIEVPLSVVKPPEGLTPEDGLERQQDNTEDSDGDQKMC
RGFFFKEDGKAEENMAQKRAALLEKRMRREKESLQKKMQLEAELEQKKEEARLKAEEERL
RKEEDKARREFIKQEYLRRKQLKLMEDMDAVIKPRASGGAKQRRGRPKSIHRDSLDSPKT
PVRAATVCSLSLASLNLGDSDSVHSDLTLCSRPDSADGFLSPSRSSSRNGEKDWENGSTT
SSVTSNTEYTGPRLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKNKILEQMEKCEANNF
LILFRDAGCQFRSVYTYCPETEDITRLAGIGPKSVTRRMIDGLYKYNSDKKQFSQIPAKT
MSASVDAVTIHNHLWQTKKPATPKKVVPAQ
Download sequence
Identical sequences H2TM89
ENSTRUP00000025795 31033.ENSTRUP00000025795 ENSTRUP00000025795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]