SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TMD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TMD5
Domain Number 1 Region: 67-253
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.66e-24
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 2 Region: 374-415
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000123
Family SOCS box-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2TMD5
Sequence length 436
Comment (tr|H2TMD5|H2TMD5_TAKRU) Ankyrin repeat and SOCS box containing 6 {ECO:0000313|Ensembl:ENSTRUP00000025841} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=asb6 OC=Takifugu.
Sequence
MPFLHGFRRIIYEYQPLVDAIMCAVGMEEGDQGDRVRSPEEQSGICSSLVELLERESHSE
VFREGISYALFKVAERGLLYAAEILLRYGADLNFEDPVSYYNPLHVAVLRNRPTMVRLLV
SHGADIEKRDRIHESSPLDLASEESERLLCLLTLLDMGADVNAGDKHRKTPLLHALASSD
GLTVHNTGNIQLLLQRGADISAATQDGETVESLLVFLIKEALDANEEDAAEIGKFCLKTT
RLLLAHGLDPSCCLNEDGESSLTRTSLEHFDLLFPLAVLLIQSGSSLVCSLHGDSCWFAY
GLLFQRLQTALQQSSDQSHALELIEQAEALLNLARVDLPVLRAPSWLEIPEQSHDPHPYS
QALLDLRDRILARDSNPPALRCLCRAFIRGQLQPWPLEDRVKTLPLPDRLKEFLLPELTY
TPKPGWDRFKPQHSHS
Download sequence
Identical sequences H2TMD5
ENSTRUP00000025841 31033.ENSTRUP00000025841 ENSTRUP00000025841 XP_003974551.1.43653 XP_011613510.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]