SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TPB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TPB1
Domain Number 1 Region: 399-572
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-49
Family SPRY domain 0.00052
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 149-214
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000029
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  H2TPB1
Domain Number - Region: 270-347
Classification Level Classification E-value
Superfamily EspA/CesA-like 0.0314
Family EspA-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2TPB1
Sequence length 577
Comment (tr|H2TPB1|H2TPB1_TAKRU) Tripartite motif containing 25, like {ECO:0000313|Ensembl:ENSTRUP00000026517} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
MTSKLWTNEQFNCPVCLDLPNDPVTIPCGHSYCMACIKDFWSNDEPKGIYSCPQCRQVFC
PMPPLSKNTMLADAVEQLRKGALKADVRDSIRSARGGTTSSSRPKAVACDMCKGEQREAV
KSCLVCMSSYCEAHLKPHQTKKALKQHELVAPTSNLAEKICTQHKYLQEFFCRQCKTFIC
WLCTSNQHKGHESVSTKVERLEKQKVLSDLQAETQQRLKEREQELKNLKKVMEVTKRSAI
KVHSDTEQTLKELQRSVERLQELMEEVLDQANLEKMSQAQEVADSLEAEIKVLKKRDSDM
KDLAQCEDHIHYLQTCESMNSPLDTGDLPAVAVNLEASFEPVRDTVLDLREQVEDLCNQE
LGKFTKQRPHQLTQTSRTTEKRVREINIDSLQAPEPRSREEFLQYSVTLTLDPNTAHRRL
GISEGNTKATLQGAAQPYPDTPERFDGWTQVMCQGPMYAQRCYWEVEWRGRGSSIGVAYG
AMSRKGSDAMSGLGYNARSWTLELSDTCCAALHDNQKRDIPVTYSPRLGIYLDLSSGMLA
FYSVADTMTHLHTFHANFTQPLYAVFGVGSGVGVGLD
Download sequence
Identical sequences H2TPB1
ENSTRUP00000026517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]