SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TQ73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TQ73
Domain Number 1 Region: 10-121
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-20
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 1007-1106
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000101
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2TQ73
Sequence length 1645
Comment (tr|H2TQ73|H2TQ73_TAKRU) LIM domain 7a {ECO:0000313|Ensembl:ENSTRUP00000026830} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
FFLQAVTKKTFGSDDFRSALENGILLCDLINKIKPGTIKRINRLPTPIAGLDNLNVFLRA
CGKLGLKDAQLFHPGDLQDLSSRVTVKDQETNRRLKNVLITIYWLGRRAQCDQLYDGPYL
NFKAFEGLLGTALYKALHESPSLRDSSIRDSGFGDSWYSEREEPPHFRGAQAGGGGSVHK
RDNSLDSLNSLSSQAHSISSDTTIKGSSEGCCSDTEADSVFKMTDNTQNISYRRSVSITP
KATAPFNQFLPSKDKSSGYVPAPLRKKRAERNEDIRHSWTSASTEEDRILTRFDLLSLLS
SSGETQPPKCGSVKVDHLKNDEDDEVGYADPIQDDLYARKMGIKSQPFGNECHNQFLPKL
WTPEEDFHIQKIKTGSQRRPWYKKIQGFSIYLHCSHLQDDFFFHTPPLVFAPMDPTSGPK
LVKCQRWPIFGRKDLPEPPDTFDYESVVPDLENDDMFTRRTLTFQSNMNLAMAKTQLPSR
RRLCTSDPQLNIITQKHKHGIPQVGDFPDIEMDDVVYRKEKTQQAQQQRPLSGAPDNYAP
MPIPEPWALPPDLKARLLCPPCPLTQEEAASNQDQVEKDTYLPTDDMLIRKLGNCPEDCK
SSLTGPPANPLTPSVTLSCCEADLQRWQAIREASQLRYKKRLMVERLAGGIWGNFMSKST
NDIQLPVDAGARRYEQLQNFRDQIKESESQWQDDLSKWKNRRRSVNSDIVKKKEEREKIE
QITSSDNYSRRSKTFREMQDERSQTIDTPYYSYDTHDRSLKQDEPPTASTATGRAASPPT
SRLGPSYSDTAKTEKTTTAASSFSSVQKVREPTRPLLRTKAEVEIPSSKHQPQPSSMESN
PPALSRVSASLPRSYQRSDSARLTSVVAPRPFGAQTSRITSLPRAFTVDDPQSRVNGDGS
KKSAAPSRYQQFMTSEDEADSSSAHSSNEEEEEEEEVEKDRTTVTSTSVSTVLPPVKDEA
LVSSAPVFSSEHFLLSNYKNSKNSKNIRMICDVQESHCEMRISLNQKPNSSRDFGFQAVW
DSTGARVMSVQPGTGSQAEMCQLQSGDEVLTVNRHQVAEMSYTDWKSRMEEALQEGSLVM
DIRRHGKDKKSSVNPSLDFTSRVSTDTQAPREPPTRTVIVSETQSLQGNDVASSGVNGGF
CEEPLNMRNKESESISLKNLKRRSEFFEKGGPEAVMPDILVPPIVPPASRWSWDPEEERR
RQEKWQKEQERLLQEKYKRDQEKLQAEWLKAQQEIAKNTEQQQPRTLEVNSQSPVSISPR
APLSPLKQATSHPWEEEERKRKEEQEQQWQAGRRRREEEEREQQRLQAERRRREEEEREQ
QRLQVERRRKEEEEEQERQRLQAERRRKEEEEERERQQLQAERRRKEEEYVINCFQQSLL
GFFLFIDRMKSKSTPQLDQDEKTPWKANSRAVGDSRGQQPPTQANVERQQILNEMKKKIP
LLTDSSWIRQGSSSTASNVRETNLPPMRRGESLDNLDAPSTWRSSWTPRSNSFVPNHNPL
PSAFSGSDVISSGGSGVQRPSTLPTSYSVGHLRGGAGTPSFPSSKQSPLPSPLSPTRSPE
PWNNAGSRSVSGKKICTFCDIPLGKGAAMIIESLGLCYHLSCFKCFDCKAELGGSEAGAE
VRIRNKQLYCNLCYMRFKTATPTEM
Download sequence
Identical sequences H2TQ73
ENSTRUP00000026830 ENSTRUP00000026830 31033.ENSTRUP00000026830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]