SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TT62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TT62
Domain Number 1 Region: 813-985
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0058
Further Details:      
 
Domain Number 2 Region: 960-1062
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0052
Further Details:      
 
Domain Number 3 Region: 158-203,301-387
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-27
Family Phosphotyrosine-binding domain (PTB) 0.0082
Further Details:      
 
Domain Number 4 Region: 11-148
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-20
Family Phosphotyrosine-binding domain (PTB) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2TT62
Sequence length 1199
Comment (tr|H2TT62|H2TT62_TAKRU) TBC1 domain family, member 4 {ECO:0000313|Ensembl:ENSTRUP00000027870} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=tbc1d4 OC=Takifugu.
Sequence
MESLAEKDNCSSKSGRRFSLTYIGWSALDRRTTLPMLPWLVAEIRRRSEKGDCGPVVQPR
EVHLVLNPPFVRCVPSSSTNSSVFIFEHKAQLISRFIHNSNDLTYFAYLLRGQPDNPESQ
MSCHVFKACDPNQVSEVICRIRQVSKSVLKGDAKPKQEADEAFYNSQKFEVLYCGKVTVM
HKKAPPTLVDDCIDKFHQHEVEQKRLRLLNGQRGSMEHNPVEFLIGGEGDKVPPSLTDRG
SFPECILEDSGFEEPQEFRTRCSSLAGSLQMKPGEGVIMGPPRRRHSSAPNHVQPSNAEK
NRTMLFQVGRFEVNLISPDSKTVVLEKNFKDISSCCQGIKHSDHFGFICRDQLDSGPSQY
VCFVFQCASESLVEEVMLTLKQAFSTAAALQSNKTEIQLCEACPIHDLHKLCERIEGLYP
PRAKIAIQKYLSQLTDNEQAEIFERVQKLKPRSDQEENELVIFHLRQLCDNKQTSHVHIG
EKVKQTLKNAVSSASGADSSASASRFKLDLLKNKARTSLTNSLENIFARLHSLKSVTEDH
LSLSSVQSQHDIFLIPLKSPASCVVCNHAGQSLPLTRSSLHLFGLEAPDEESPGPSPPGS
PPTFAENDPENGVQFRRRAHTFSHPPVKKRISFEGQSNSQSKAALHRQQSVNPELLQSSN
GEGRKRTLSSCSNDSLSWGLPPTPRRVSWRQKIFLRVASPMSKSPAPMHHPDDSKGQELL
PLSPHSRRSVMDPSRHLLPPGEKPKRTSADYRALWKTAIHQQILLLRMEKENQRLEASRD
ELHIRKMKLNYQEVGQCSKDAQALWERKLTAPGRTTVQQDKKELYHALCQGVPKNRRGEV
WLLLSYQHRLRHRLPQRLHAPDTPYQDLLKQLTAQQHAILVDLGRTFPTHQYFSAQLGAG
QLSLYNLLKAYSLLDTEVGYCQGISFVAGVLLLHMSEEQAFDMLRFLMYDLGIRQQYKPD
MISLQIQMYQLSRLLHDYHRELYTHLEDHEISPSLYAAPWFLTLFASQFPLGFVSRIFDF
VFVQGTGVIFKVALCLLSSHEGEIMECDSFESIVDYLKSTLPALSQSQMEQTIAKVVDMD
ISKQLHAYEVEYHVLQDEMLDAGAVLDDSDRLDKLEKTNMQLKRQNMDLLEKLQAARQKI
QSLETSVENFLSRESKMKHMIRSLEQEKAAYQKTIERMRSCLPLDTPTDVEMTQIKTGP
Download sequence
Identical sequences H2TT62
ENSTRUP00000027870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]