SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TTF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TTF9
Domain Number 1 Region: 266-384
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.79e-54
Family Calsequestrin 0.0000018
Further Details:      
 
Domain Number 2 Region: 164-265
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.78e-27
Family Calsequestrin 0.0000454
Further Details:      
 
Domain Number 3 Region: 41-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.96e-22
Family Calsequestrin 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2TTF9
Sequence length 399
Comment (tr|H2TTF9|H2TTF9_TAKRU) Calsequestrin {ECO:0000256|RuleBase:RU000648} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101061703 OC=Takifugu.
Sequence
HTHTHTPSPCPLPSLCLTRSFIFSIQTTGLLKMGLSSEKGLEFPQYDGKDRVVDINDKNY
KKALKKHSMMCLFYHGPIPDSKELQKQHQMTEMVLELAAQVMEEKDIGFGMVDSQKDSKV
AKKLGLQEEGSTYVFKEDRVVEFDGLLSANTLVEFLLDLLKEPVEVIGNALELRAFDRME
EDIRLVGYFKNEDSEHYEAFKEAAEQFQPYIKFFATFDKSVAKELTLKLNEVDFYEPFME
EPLTIPGKPHTEEELVEFIMEHRRPTLRKLRAEDMFETWEDDIEGIHIVAFAEEEDPDGF
EFLEILKQVARDNTQLPELSIIWIDPDDFPLLIPYWEKTFKVDLFRPQIGVVNVTDADSV
WLEMDDEEDLPTPQELEDWIEDVLAGKVNTEDDDDEEED
Download sequence
Identical sequences H2TTF9
ENSTRUP00000027967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]