SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TTG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TTG1
Domain Number 1 Region: 249-314,342-394
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.64e-46
Family Calsequestrin 0.00000228
Further Details:      
 
Domain Number 2 Region: 147-248
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.97e-27
Family Calsequestrin 0.0000454
Further Details:      
 
Domain Number 3 Region: 24-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.97e-22
Family Calsequestrin 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2TTG1
Sequence length 409
Comment (tr|H2TTG1|H2TTG1_TAKRU) Calsequestrin {ECO:0000256|RuleBase:RU000648} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101061703 OC=Takifugu.
Sequence
MLSLLLFALSCLSLAPLSPAEKGLEFPQYDGKDRVVDINDKNYKKALKKHSMMCLFYHGP
IPDSKELQKQHQMTEMVLELAAQVMEEKDIGFGMVDSQKDSKVAKKLGLQEEGSTYVFKE
DRVVEFDGLLSANTLVEFLLDLLKEPVEVIGNALELRAFDRMEEDIRLVGYFKNEDSEHY
EAFKEAAEQFQPYIKFFATFDKSVAKELTLKLNEVDFYEPFMEEPLTIPGKPHTEEELVE
FIMEHRRPTLRKLRAEDMFETWEDDIEGIHIVAFAEEEDPDGFEFLEILKQVARDNTQLP
ELSIIWIDPDDFPLVSHEPFSLRTSHGWSCMAFHIAADSFQLIPYWEKTFKVDLFRPQIG
VVNVTDADSVWLEMDDEEDLPTPQELEDWIEDVLAGKVNTEDDDDEEED
Download sequence
Identical sequences H2TTG1
ENSTRUP00000027969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]