SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TU40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TU40
Domain Number 1 Region: 87-221
Classification Level Classification E-value
Superfamily BAG domain 5.1e-50
Family BAG domain 0.0000111
Further Details:      
 
Domain Number 2 Region: 26-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000599
Family Ubiquitin-related 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2TU40
Sequence length 221
Comment (tr|H2TU40|H2TU40_TAKRU) BCL2-associated athanogene 1 {ECO:0000313|Ensembl:ENSTRUP00000028198} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=bag1 OC=Takifugu.
Sequence
LSRTQKSTMSEQSITVTVAYAFIFLTSGSTKHNITLTTHDETGPFVKDLSDALTAATGVP
QTSQKIIFKGKSLKDMEERLTSYGVKEGCKLMMIGKRNSPEEEAELKKLKDIEKSVEQTA
KKLEKVGGELTGLKNGFLAKDLQVEALGKLDHRVKTAAEQLMKTLEQIDALSVPENFSDC
RLKKKGLVKTVQGFLAECDKIEACISDHLSKIQSKNLALAD
Download sequence
Identical sequences H2TU40
ENSTRUP00000028198 31033.ENSTRUP00000028198 ENSTRUP00000028198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]