SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TUC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TUC7
Domain Number 1 Region: 869-1131
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000185
Further Details:      
 
Domain Number 2 Region: 1100-1402
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-80
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000114
Further Details:      
 
Domain Number 3 Region: 2-161
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-38
Family MAM domain 0.00000687
Further Details:      
 
Domain Number 4 Region: 363-567
Classification Level Classification E-value
Superfamily Fibronectin type III 6.95e-28
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 5 Region: 259-395
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000438
Family Fibronectin type III 0.0078
Further Details:      
 
Weak hits

Sequence:  H2TUC7
Domain Number - Region: 162-260
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000406
Family I set domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2TUC7
Sequence length 1405
Comment (tr|H2TUC7|H2TUC7_TAKRU) Protein tyrosine phosphatase, receptor type, U, a {ECO:0000313|Ensembl:ENSTRUP00000028286} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
AGCTFDQDSDPGFCDYRQGQDDDFDWQLIRTYNWPHPTPDLLRGSFMMVNSSQHFGGQRA
QLLLLPLSENDTHCIQFSYFLYSRDGHSPGDLQVYIRVNGGPKGSAVWNISGSQGRQWHQ
VELAVSTFWPSEYQVIFEATVSEERQGYVALDDIVLLNYPCYKVPHFSRLGDVEVNAGQN
ASFQCVATGKVSESEPFLLERRSGLLLDAPALSRLSHKRLMATFQVEAQRGEQDLYRCVT
LSPRGAAISNFGELIVRVPPTPIAPPQLLRAGPTYLIIQLNTNSIVGDGPVIRREIQYRA
SQSMWTETHGVGSLTYKVWHLEPDTEYHISVLLTRPGEGGTGAPGPPLISRTKCAEPMRA
LRGLTASDIQPRQLTLQWEPLGYNLTRCHTYTLSLCYRYSVPTGGSGGNNATVRECLSVD
RNTSRFTLRDLPPFHSVHVRLALSNPEGKKESREVTFQTEEDIPGGIAPESLTFTPLDDM
IFLKWEEPVEPNGLITQYEISYQSIESSDPGINVPGPRRTVSKLRNETYHMFSGLHPGTT
YLVSVRARTAKGFGQTALTEITTNISAPVFDYEDVPSPLSESESTITVLLRPALARGAPV
SAYQVVVVEEDGSRQVRRREVGPVDCFPTPSSHSSQSRGAPHYYTAELAPSSLPEATPFT
VGDNHTYNGYWNSPLDPTKNYLIYFQATSNFRGETRINCIRIARKAACKDSKRALEVSQH
AEDMGLILGACVGGLVVLVLLLGAVVVIVKKGEAFGNKSELQPERRSAGALILNSPPAAK
RPFSFLSQDKKKSHLLISRSAPRPSAQIAPVVCPPPPPRPAVRRRSSDSRAALARRPLNY
MSGEQLRGAGGRAGNWLVQSFFDGWDVSKKKDKTKGRHDSLLSHDRHRVKLHSLLADPCS
DYVNANYIDGYQRSNHFIATQGPKQEMIYDFWRMVWQENCFSIVMITKLVEVGRMKCCKY
WPDDTELYGDIKITLLKTETLAEYTVRTFAMERRGYPAKHEVCQFHFTSWPEHGVPYHAT
GLLAFLRRVKASTPPDAGPVVVHCSMGAGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLC
SRRINMIQTEEQYVFIHDAILEACLCGETAVPVNEFALTFKEMLKVDTQSNTSQLREEFQ
TLNSVTPHLDVEECSISLMPRNREKNRSMDVLPPDRSLAFLVTTDGESSNYINAALADSF
LRPAAFVVTPHPLPGTTTDFWRLVYDYGCTSVVMLNQLNQSNSAWPCLQYWPEPGLQQFG
PMTVELLSRTADDDVIIRLFRVQNITRLQEGQLVVRHFQFLRWSPYRDVPDSKKAFLSLL
AQVHNWQRECGEGRTVVHCLNGGGRSGTFCACTMILEMIRHHSVADVFFAAKTLRNAKPN
MVETMEQYRFCYDLAQEYLECLEVR
Download sequence
Identical sequences H2TUC7
ENSTRUP00000028286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]