SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TUD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TUD0
Domain Number 1 Region: 833-1105
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.81e-88
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000185
Further Details:      
 
Domain Number 2 Region: 1066-1366
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000114
Further Details:      
 
Domain Number 3 Region: 4-124
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-30
Family MAM domain 0.0000201
Further Details:      
 
Domain Number 4 Region: 326-530
Classification Level Classification E-value
Superfamily Fibronectin type III 6.71e-28
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 5 Region: 222-358
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000389
Family Fibronectin type III 0.0078
Further Details:      
 
Weak hits

Sequence:  H2TUD0
Domain Number - Region: 125-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000421
Family I set domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2TUD0
Sequence length 1369
Comment (tr|H2TUD0|H2TUD0_TAKRU) Protein tyrosine phosphatase, receptor type, U, a {ECO:0000313|Ensembl:ENSTRUP00000028289} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
PCSPPAGSFMMVNSSQHFGGQRAQLLLLPLSENDTHCIQFSYFLYSRDGHSPGDLQVYIR
VNGGPKGSAVWNISGSQGRQWHQVELAVSTFWPSEYQVIFEATVSEERQGYVALDDIVLL
NYPCYKVPHFSRLGDVEVNAGQNASFQCVATGKVSESEPFLLERRSGLLLDAPALSRLSH
KRLMATFQVEAQRGEQDLYRCVTLSPRGAAISNFGELIVRVPPTPIAPPQLLRAGPTYLI
IQLNTNSIVGDGPVIRREIQYRASQSMWTETHGVGSLTYKVWHLEPDTEYHISVLLTRPG
EGGTGAPGPPLISRTKCAEPMRALRGLTASDIQPRQLTLQWEPLGYNLTRCHTYTLSLCY
RYSVPTGGSGGNNATVRECLSVDRNTSRFTLRDLPPFHSVHVRLALSNPEGKKESREVTF
QTEEDIPGGIAPESLTFTPLDDMIFLKWEEPVEPNGLITQYEISYQSIESSDPGINVPGP
RRTVSKLRNETYHMFSGLHPGTTYLVSVRARTAKGFGQTALTEITTNISAPVFDYEDVPS
PLSESESTITVLLRPALARGAPVSAYQVVVVEEDGSRQVRRREVGPVDCFPTPSSHSSQS
RGAPHYYTAELAPSSLPEATPFTVGDNHTYNGYWNSPLDPTKNYLIYFQATSNFRGETRI
NCIRIARKAACKDSKRALEVSQHAEDMGLILGACVGGLVVLVLLLGAVVVIVKKGAALAR
RPLNYMSGEQLRGAGGRAGLNVSPVERILKWIRSGIPTPTPRNRGNPLMGGRLRGSQTPP
PPPFPPPPPHSAGVGRCRAELVLLFTLMIIGFLLLNALFPVVQSFFDGWDVSKKKDKTKG
RHDSLLSHDRHRVKLHSLLADPCSDYVNANYIDGYQRSNHFIATQGPKQEMIYDFWRMVW
QENCFSIVMITKLVEVGRMKCCKYWPDDTELYGDIKITLLKTETLAEYTVRTFAMERRGY
PAKHEVCQFHFTSWPEHGVPYHATGLLAFLRRVKASTPPDAGPVVVHCSMGAGRTGCYIV
LDVMLDMAECEGVVDIYNCVKTLCSRRINMIQTEEQYVFIHDAILEACLCGETAVPVNEF
ALTFKEMLKVDTQSNTSQLREEFQTLNSVTPHLDVEECSISLMPRNREKNRSMDVLPPDR
SLAFLVTTDGESSNYINAALADSFLRPAAFVVTPHPLPGTTTDFWRLVYDYGCTSVVMLN
QLNQSNSAWPCLQYWPEPGLQQFGPMTVELLSRTADDDVIIRLFRVQNITRLQEGQLVVR
HFQFLRWSPYRDVPDSKKAFLSLLAQVHNWQRECGEGRTVVHCLNGGGRSGTFCACTMIL
EMIRHHSVADVFFAAKTLRNAKPNMVETMEQYRFCYDLAQEYLECLEVR
Download sequence
Identical sequences H2TUD0
ENSTRUP00000028289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]