SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TUD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TUD3
Domain Number 1 Region: 829-1100
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.8e-88
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000185
Further Details:      
 
Domain Number 2 Region: 1061-1201
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.86e-31
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0015
Further Details:      
 
Domain Number 3 Region: 2-120
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-29
Family MAM domain 0.0000226
Further Details:      
 
Domain Number 4 Region: 322-526
Classification Level Classification E-value
Superfamily Fibronectin type III 5.75e-28
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 5 Region: 218-355
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000026
Family Fibronectin type III 0.0078
Further Details:      
 
Weak hits

Sequence:  H2TUD3
Domain Number - Region: 121-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00037
Family I set domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2TUD3
Sequence length 1235
Comment (tr|H2TUD3|H2TUD3_TAKRU) Protein tyrosine phosphatase, receptor type, U, a {ECO:0000313|Ensembl:ENSTRUP00000028292} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
PAGSFMMVNSSQHFGGQRAQLLLLPLSENDTHCIQFSYFLYSRDGHSPGDLQVYIRVNGG
PKGSAVWNISGSQGRQWHQVELAVSTFWPSEYQVIFEATVSEERQGYVALDDIVLLNYPC
YKVPHFSRLGDVEVNAGQNASFQCVATGKVSESEPFLLERRSGLLLDAPALSRLSHKRLM
ATFQVEAQRGEQDLYRCVTLSPRGAAISNFGELIVRVPPTPIAPPQLLRAGPTYLIIQLN
TNSIVGDGPVIRREIQYRASQSMWTETHGVGSLTYKVWHLEPDTEYHISVLLTRPGEGGT
GAPGPPLISRTKCAEPMRALRGLTASDIQPRQLTLQWEPLGYNLTRCHTYTLSLCYRYSV
PTGGSGGNNATVRECLSVDRNTSRFTLRDLPPFHSVHVRLALSNPEGKKESREVTFQTEE
DIPGGIAPESLTFTPLDDMIFLKWEEPVEPNGLITQYEISYQSIESSDPGINVPGPRRTV
SKLRNETYHMFSGLHPGTTYLVSVRARTAKGFGQTALTEITTNISAPVFDYEDVPSPLSE
SESTITVLLRPALARGAPVSAYQVVVVEEDGSRQVRRREVGPVDCFPTPSSHSSQSRGAP
HYYTAELAPSSLPEATPFTVGDNHTYNGYWNSPLDPTKNYLIYFQATSNFRGETRINCIR
IARKAACKDSKRALEVSQHAEDMGLILGACVGGLVVLVLLLGAVVVIVKKGAALARRPLN
YMSGEQLRGAGGRAGLNVSPVERILKWIRSGIPTPTPRNRGNPLMGGRLRGSQTPPPPPF
PPPPPHSAGVGRCRAELVLLFTLMIIGFLLLNALFPVVQSFFDGWDVSKKKDKTKGRHDS
LLSHDRHRVKLHSLLADPCSDYVNANYIDGYQRSNHFIATQGPKQEMIYDFWRMVWQENC
FSIVMITKLVEVGRMKCCKYWPDDTELYGDIKITLLKTETLAEYTVRTFAMERRGYPAKH
EVCQFHFTSWPEHGVPYHATGLLAFLRRVKASTPPDAGPVVVHCSMGAGRTGCYIVLDVM
LDMAECEGVVDIYNCVKTLCSRRINMIQTEEQYVFIHDAILEACLCGETAVPVNEFALTF
KEMLKVDTQSNTSQLREEFQTLNSVTPHLDVEECSISLMPRNREKNRSMDVLPPDRSLAF
LVTTDGESSNYINAALADSFLRPAAFVVTPHPLPGTTTDFWRLVYDYGCTSVVMLNQLNQ
SNSAWVRTPPVPAMVAVPRRARLQEGLPQPAGPGP
Download sequence
Identical sequences H2TUD3
ENSTRUP00000028292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]