SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TVE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TVE8
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily L domain-like 1.25e-53
Family Ngr ectodomain-like 0.02
Further Details:      
 
Domain Number 2 Region: 192-421
Classification Level Classification E-value
Superfamily L domain-like 1.09e-43
Family Internalin LRR domain 0.047
Further Details:      
 
Domain Number 3 Region: 485-793
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.01e-28
Family Rhodopsin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2TVE8
Sequence length 853
Comment (tr|H2TVE8|H2TVE8_TAKRU) Leucine rich repeat containing G protein-coupled receptor 6 {ECO:0000313|Ensembl:ENSTRUP00000028657} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LGR6 OC=Takifugu.
Sequence
CPSPCQCEQDGIFVMVDCSELGLSSVPTNLSPLTTYLDLSMNNISEIQSGAFQRLHLLSE
LRISGNQLRYIPGHALQGLHNLKVLMLQNNQLERLPDDAPWDLPNLLSLRLDANLLSEVP
AWAFRGVSSMRHLWLDDNSLTEIPVAALDSLPSLQAMTLALNKITHIPDYAFTNLSALVV
LHLHNNHIQTMDPRCFEGLHSLETLDLNYNDLQEFPVAIRTLSKLQEFHFYENPIQLVGK
SAFQFLPKLHTLSLNGATQIQEFPDLKGTSSLEILTLTRAGLSALPPDLCEQLPRLRVLE
LSYNQIEHLPSFYRCSSLQEIGLQHNQIRRIESSTFQQLTSLRALDLSWNLIERIHPDAF
ASLQSLLKLDLTENRLSSVPVTGLGGLTHLKVRGNAELYDAFSPDHFPRMRVIEMPYAYQ
CCVYGSCDSYKPASQWDAEQGHVDEDLHKRTAPMYPVHVDAHYDPDLEEFQLEIEESKLQ
ASVQCSPTPGPFCPCDSLLGSWPVRVGLWFISLVSLLGNSLLLLSLFSSPGYLSPLRFTV
ACMGASNLLTGMCTGTLAFVDALTLGEFADHGARWEAGSGCQATGWVWVFASEASVLLLT
LAAVQCGVSMTCARAYGKLPSLGSVRTCALFCLVLSLALASLPLVGVGEYGSSPFCLPSP
LPPPSSRLPSSLGFSLALIMMNTLCLLIVTGSYIRLYWDLLRGECDGLWDCTMIKHVAWL
IFTNGLLYVPVAFLSLCSLLGLLSLGEEVLKSVLLLLQPLPACLNPLLFLLFTRDLSQFF
LWPYPKERPKLRRDRTLDSLVSVGTEKSSCSDSSTLAESEVLYSAAPACHSHRDHVRFSQ
SSSASSLLLIPCQ
Download sequence
Identical sequences H2TVE8
ENSTRUP00000028657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]