SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2TY31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TY31
Domain Number 1 Region: 702-931
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-61
Family DBL homology domain (DH-domain) 0.0000000335
Further Details:      
 
Domain Number 2 Region: 310-496
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.25e-59
Family Regulator of G-protein signaling, RGS 0.0000116
Further Details:      
 
Domain Number 3 Region: 933-1067
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-36
Family Pleckstrin-homology domain (PH domain) 0.0000142
Further Details:      
 
Domain Number 4 Region: 13-105
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-21
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2TY31
Sequence length 1131
Comment (tr|H2TY31|H2TY31_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000029590} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101069223 OC=Takifugu.
Sequence
TDNKPKHEKPSSPLKHEFDPTGLVQRCVIIQRDKNGFGLTVSGDNPVFVQLVKENGAAMR
AGVQTGDRIIKVNGTLVTCSNHMEVVKLIKSGSYVALTVLGRPPGLPLQDEEEPEDTLEG
TGPQHDGINYESPEGLILTIVFESEDKTSHCQNVDVIQKMLNQEHHELQVQSLLSPAVEP
SGVRFHRNRGKIARLFQDGAMRSRSSETEDGAVGAQTSTSGADSLDKGETPCQSGDITLR
PSADGEDAPETVKETPSCTFLPMESDPSSRQETGAQFLIPPHPLNPQIIGAEDDYFDSQQ
EQHQINGECSSFQSVDLLKSRPAHLAVFLHHVISQFDPAPVLCYLYADMHKHANSKESRR
FFMEFHSLFLDRTANLKVPLPETIASELEKRRLELLPEDLCRQFTQTLQEMLLPDLHRHL
EDFRQKRSMGLTLAEDELSRLDAEPGKEVLDRECSCAEHILSKIEDILSASQPTEEEKCQ
TMQYVILTYMKQLGVKVKEPRGLEHKRARINFLPKIKKSIKPEKEGEEKVKKPRFHNILN
PPRRLSRVDSTSVGKAVALNKQRSPKHPSPPADHADCSAATAGRVTGNQLSDGSDTSSQF
SPSTTSPTHSTPPTQGSDTSGQLKMGEGLQSGDHQEGISSSTCTQFDFSPTNLEQLQEDD
QETFMCVCVVVTRMEVQCSVSPAEVHSEDDQGGEMECEEDRQNWQSLVSPGVLAGLTPQE
IKRQEVINELFYTERAHLRTLKVLDSVFYQRLKGDGILPPEDIKLIFINLEEIIQLHVSV
TEQMLVTRKRNETSVIGQIADDLLAWFGGEEEEKIKSAVGTFCSNMPSALELIKSKKKKD
QRFSLFMQAAERNRLCRRLQLKDIIPVEMLRFTKYPLLLDNIAKYTEDDEEKEKVKKAAE
CCKKILYHVNQAVKEAENRRRLMDYQRRLDISSLKQSENPIILELKNLDLTKRTMVHEGP
LSWRVNKDKRIELYAILLEDILVLLQKQDERLVLKFHGKNQASAADAKNIFSPVIKLNTV
LVRPVATDNKSFFVLSMSENGAQIYKLTAQSVSDQRTWQCLITQCADAMKAKSDKNKPPP
AQADIQEVAEEEGDEEVDEAELEAFLDGQLADGLIFLQDQEQNQEPRTICE
Download sequence
Identical sequences H2TY31
ENSTRUP00000029590 ENSTRUP00000029590 31033.ENSTRUP00000029590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]