SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2U0J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2U0J6
Domain Number 1 Region: 356-473
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.9e-30
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2U0J6
Sequence length 475
Comment (tr|H2U0J6|H2U0J6_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000030455} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
SLVQFKNTLQAAIKEVQVDVRAFKEQIVQKMEELSDSSRPLAGVVSRLQEENLQLRAKLE
ALSCLVEGLTGVKVDHSTIECVGPKISQSTSIEPPGPSGGSNASVGTGPSNTSVPPPWRT
RRQAERQIRLYDVTDAVYTKIAPPGMWTPVSPGLMENGTESSLAESSEMIRRSSVPPTSD
LHSQNPDPIKLNKVHHPAPADTKATLEASAGPDSPATTCKVPQKQAAEPDLVCSSQHSSP
AHVQLLNSAEDANEAQLHRPTTATSTKPSSEERFSSKLIQPVADAAEPPKGGSGEHSVKT
AGRKSAWAGTEFKQDVTRAQVPSRPSGAQARRAMFERMNTEPVNRAKESKPKLKRSQSFG
VSSASGIKQILLEWCRSKTIGYQNIDIQNFSSSWSDGMAFCALVHSFFPLEFDYNTLDAR
KRKQNLELAFSTAEKQADCLRLIEVDDMLEMGDKPDPMCVFTYVQALYNHLKKFE
Download sequence
Identical sequences H2U0J6
ENSTRUP00000030455 ENSTRUP00000030455 31033.ENSTRUP00000030455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]