SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2U136 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2U136
Domain Number 1 Region: 27-178
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.68e-30
Family Calponin-homology domain, CH-domain 0.0029
Further Details:      
 
Domain Number 2 Region: 202-281
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.26e-29
Family GAS2 domain 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2U136
Sequence length 315
Comment (tr|H2U136|H2U136_TAKRU) Growth arrest-specific 2a {ECO:0000313|Ensembl:ENSTRUP00000030647} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=gas2 OC=Takifugu.
Sequence
MCSSLSPKHPGVPGLTDMQQYHQWLASRHEASLLPMKEDLALWLTNILGLEITSETFMER
LDNGFLLCQLAETLQERFRQNNGSKVWTESVPYRRIPCRQSAPSGSFFARDNTANFLAWC
RKVGVGEMCLFESEDLVLHKQPREVCLCLLELGRIASRYNVEPPGLIKLEKEIEQEERAP
QPPPSPVSTAKITPSRKSTGKLLDEAVRHIADDPPCRCLNKFCVERQSQGRYRVGEKMLF
IRMLHNKHVMVRVGGGWETFESYLLKHDPCRMLQFSRVEGKTSPGGGSRPPTLKEISPDG
YLVVAAHYRGKKQLH
Download sequence
Identical sequences H2U136
31033.ENSTRUP00000030647 ENSTRUP00000030647 ENSTRUP00000030647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]