SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2U1H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2U1H6
Domain Number 1 Region: 194-397
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-50
Family DBL homology domain (DH-domain) 0.000000338
Further Details:      
 
Domain Number 2 Region: 2-230
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-41
Family Calponin-homology domain, CH-domain 0.0035
Further Details:      
 
Domain Number 3 Region: 383-544
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-30
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 4 Region: 639-769
Classification Level Classification E-value
Superfamily SH2 domain 4.01e-26
Family SH2 domain 0.00066
Further Details:      
 
Domain Number 5 Region: 791-845
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-22
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 6 Region: 594-668
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000177
Family SH3-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2U1H6
Sequence length 846
Comment (tr|H2U1H6|H2U1H6_TAKRU) Vav 3 guanine nucleotide exchange factor b {ECO:0000313|Ensembl:ENSTRUP00000030787} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101076765 OC=Takifugu.
Sequence
MEYWRQCAMWLISCNVLPKNHRVVADRAQVFDLAQTLRDGVLLCQLLNNLRPHTINLKEI
NLRPQMSQFLCLKNIRTFLTSCNVAFAMKKIDLFDAFDLFDVRDFGKVMDTLSRLSHTVI
AQQGGSKPFPTEESLKDEDIYNNLEDLIDENAPEDEDDLYAAVYGMDDNCTGGKIYEDLM
RAEQPPPLVLTQAELDVRTCCLSEIKQTEEKYTETLESIEKYFLNPLKKFISAAEIDRVF
INIPDLVKVHRSLFLDVQDSILNKNASNLYQIFISYKERLLVYGIYCSQVEVAIVVLDQI
CKEKEDVRLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDATDKSNLK
VALDAMRDLAQFINEVKRDNETLREINQYQRSIENLNQPLITYGRPRGDGEVRMVSSVDK
RKQYRHIFLFDVAAIVCKRRGDNYEMKDVLDLHCFKVTNNPTSDREGKKWCYGFYVTHQQ
GHTGFELFFKTRELKKKWLDRFEMAISDIRPEKANHNSHQFKMHTFEKITSCSFCHLLLR
GIFNQGYLCLKCGLETHKECLGQLGVCGRTVSASHPAAESAKPRPKGFRNDPKFSSPGLP
RLVVIRAYSGIPSPHCGPPLSIHEGDVIELLLADLHSSWWQGKILATSKIGFFPSDAVRP
CPCVPKPVDYSSQLWFAGPMERCQAELELSDRDNSTFLVRHRSKECTEYALSIKFNDKVK
HIKILTKDGCFYIAESRLFKTVADLVEYYKQYSLKEGFRGLDTTLQVPYREPSEENRSIT
KAGSVFSPRVMAVAVARYDFASRDTQELSLLKGDIIRVYTKLPDGWWKGEVDGRVGWFPS
TYVEED
Download sequence
Identical sequences H2U1H6
ENSTRUP00000030787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]