SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2U3Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2U3Q0
Domain Number 1 Region: 360-524
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-45
Family SPRY domain 0.00033
Further Details:      
 
Domain Number 2 Region: 12-87
Classification Level Classification E-value
Superfamily RING/U-box 1.13e-20
Family RING finger domain, C3HC4 0.0082
Further Details:      
 
Domain Number 3 Region: 146-210
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.16e-16
Family B-box zinc-binding domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2U3Q0
Sequence length 531
Comment (tr|H2U3Q0|H2U3Q0_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000031561} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101078677 OC=Takifugu.
Sequence
LVKAKMAQKGFELIQGAFCCPICVDLLKDPVLTPCGHSYCKECIKAHWDSETVEGTYSCP
LCRQTFPTQPDLLNSIFLATLVEELRIGRDVPADHLYAGPDDLACDICTGRKLRAAHFCL
VCLISFCRIHIRPHVESPAYKKHKLVEPSEKLRENICSHHNELRKMFCRTDQQLICYLCS
VEEHKGHVTVSAEAETTEKQKELDTGRKTLQERIEVLEEELKVLRAENEAVNRWAGKTAE
DVEEILTGMISDVKQKEGQLSQLKELQEQVGQEITELKRRDAELKVLSHTEDHIRFLSAY
TSLPGLAQATALRRPPGCFEGVTSAVSELRDKLQEVLKQEWTSILPTQVEAPLSEPKISQ
ITLDPNTANQWLLLSEDNKSGTLMRTAESYPLHPDRFSDWHQVLSTKILTGCCYWEVEMT
GCGICVAVSYKNIRRAWRSPESGFGLNDKSWTLNCYNGIYDFWHNNIRTPVSGPRSSTVG
VYLDHNAGSLSFYSVSENTTTLLHRVQTTFTQPLYAGLGFLCYETTAEILT
Download sequence
Identical sequences H2U3Q0
ENSTRUP00000031561 ENSTRUP00000031561 31033.ENSTRUP00000031561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]