SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2U4R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2U4R8
Domain Number 1 Region: 369-527
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-46
Family SPRY domain 0.00015
Further Details:      
 
Domain Number 2 Region: 4-81
Classification Level Classification E-value
Superfamily RING/U-box 1.47e-16
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 142-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000183
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2U4R8
Sequence length 527
Comment (tr|H2U4R8|H2U4R8_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000031930} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC105419963 OC=Takifugu.
Sequence
TKPVEHLVNELSCPICFQLFCDPVVLPCGHNYCRTCIWTTASPASKSGQTPPCCPECRGK
FQDVESLQKNFKLCNIVEGFRASASHLERHFHTESEKMEVFCDHCIDEPSVAVKSCLKCE
VLLCSRHLQKHQEKESFRSHLLVDPLSELGMKSCTCHHRPLEYFCSSDMNLLCATCFIEG
HHQNHDILTFTAAEEEMRRALQSRCEHCFFFLVEKNRGHHSMKTESDHLICEKYAATRRH
ELSQFCHIFNFSHLKKSTLNNVEIDLYRERLHDLLEEEGSQYRKSWQLGLSSLEQQQHHL
MDAQNTAKQVLMETDTCIFIQRYKKNVFLAIAIRIISKIDSSKEPFQRQTSSKMTHLLDS
LHILLNPMELTFNLCTAHPSLLVSNDLHTVKYTPTKQLYPEHPERFTSAPQILCTKGFSG
GEHIWVVEVGANAMWSLGICYKSIPRCGDHSRLGHNSVSWRLQWKNSKLTVCQSSCNVAL
VEVKNHPQRVEIALDYEGGVLTFHSTKGHREHLYTFRTVFREPVYPA
Download sequence
Identical sequences H2U4R8
ENSTRUP00000031930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]