SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2U6B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2U6B8
Domain Number 1 Region: 38-509
Classification Level Classification E-value
Superfamily Sema domain 2.49e-127
Family Sema domain 0.0000142
Further Details:      
 
Domain Number 2 Region: 1364-1491,1686-1875
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.49e-50
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 868-967
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000112
Family Other IPT/TIG domains 0.0066
Further Details:      
 
Domain Number 4 Region: 965-1054
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000168
Family Other IPT/TIG domains 0.066
Further Details:      
 
Domain Number 5 Region: 1052-1155
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000267
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.096
Further Details:      
 
Domain Number 6 Region: 511-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000401
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 1152-1243
Classification Level Classification E-value
Superfamily E set domains 0.00000115
Family E-set domains of sugar-utilizing enzymes 0.043
Further Details:      
 
Domain Number 8 Region: 811-844
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000589
Family Plexin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2U6B8
Sequence length 1905
Comment (tr|H2U6B8|H2U6B8_TAKRU) Plexin A1a {ECO:0000313|Ensembl:ENSTRUP00000032484} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101062161 OC=Takifugu.
Sequence
ANMSPLTTMMYICIIALLLLFISMASTSLPPTSSSSLLFFSPPEGGLTHLVVNNKTGEVY
LGAVNWIYKLSSNLTKLRSHVTGPVTDNPRCYPPPGVQSCPHELVQTSNVNKLLLLDAAH
NRLIACGSTSQGICQFLRLDDLFKLGEPHHRKEHYLSSVAEAGTMSGVVISPDVFGGGGK
LFVGTPIDGKSEYFPTLSSRKLMSNEENADMFSFVYQDEFVSSQLKIPSDTLSKFPAFDI
YYIYGFNSEQFVYYLTLQLDTQLTSPDASSEQFFTSKIVRLCVDDPKFYSYVEFPIGCTK
DGVEYRLVQDAYLARPGIRLARSLGIQEHEEVLFTVFAQGQKNRAKPPKESALCLFTMKR
IKEKIKERIQSCYRGEGKLSLPWLLNKELACINSSPKPQPLQIDDNFCGQDFNQPLGGTS
AIEGPLYVDKDDGMTSVAAYNYRGHTVAFTGTRSGRMRKILVNSIVQPAPQYENVVVSDG
HSILRDLLFSHDHQYLYTLTDKQVTRVPVERCEQHKSCRACLGSGDPHCGWCVLLNTCSR
KDHCERAEEPQRFTTRVEQCVRLSVQPDTVSVTMSEVQLVLQAQNVPSLFAGVNCSFEDY
VETEGRIYGGRIFCLSPSRKDVLPITQNQGDQRVIKLYLKSKETGKKFASVDLVFYNCSV
HQSCLSCVNGKFPCHWCKYRHMCTQDATDCSFQEGRVNTSEECPQILPSTQIYIPAGVVR
PITLLAQNLPQPQSGQKNYECIFHIQGSTLRVPALRFNSTSIQCQKTMYDYEGSDISDLP
VDLSVVWNGIYVIDNPFNIQAHLYKCRALRASCGMCLKANPRFECGWCVQDKKCSLRQEC
TSGGSPHVALLLSESGRWMHASSGNSRCSHPKITKLFPETGPRQGGTRVTILGENLGLQF
RDIQMGVRVGKVPCLPVEEEYVSAEKIVCLLNDATSYRVQEAQVEVCVRDCVNDYRALSS
RPFTFVTPYFTRIQPSQGPISGGTRITIEGSYLNAGSYISVRFAQQPCFFKKRNAREIVC
VTPAGIAPGSTSVLVDIDDAELRNPEVRFNYTEDPTVLKIEPDWSIASGGTLLTVSGTNL
ATIREPKIRAKYGQAESFHNCTVYNNSVMVCLAPSVADSELGFSESGTGPDEIGFYMDNV
NALVVVNETFSYYPDPVFEPLSPSGVLELKPTSPLILKGRNLIPAAPGNSRLNYTVLIGE
TPCILTLSESQLLCEWPNLTGQHKVTIRAGGFEYSPGMLHIYSDSLLTLPAIIGIGGGGG
LLLLVIIAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTQEL
DGSGIPFLDYRIYAMRVLFPGIEDHPVLKEMEVQANVEKALMLFGQLLTKKNFLLIFIRT
LESQKFPRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDRNLESKNHPKLLLR
RTESVAEKMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSED
KLIRQQIDYKTLTLHCVNPEHENAAEVTVKCLNCDTITQVKEKLLDAVYKGSPYSQRPKA
SDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSVIALVPKQNSAYNIS
NSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHSDQREGDRG
SKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHSI
TDFDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKL
GKDSPSNKLLYAKDIPNYKNWVERYYSDISRMPAISDQDMSAYLAEQSRLHLSQFNSMSA
LHEIYSYITKYKDEILTALQKDEPSRRQRLRGKLEQVIDTMSLAS
Download sequence
Identical sequences H2U6B8
ENSTRUP00000032484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]