SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2U7P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2U7P2
Domain Number 1 Region: 25-467
Classification Level Classification E-value
Superfamily Sema domain 6.54e-96
Family Sema domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1356-1485,1667-1856
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-52
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 833-931
Classification Level Classification E-value
Superfamily E set domains 6.07e-16
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 4 Region: 929-1018
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000382
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 5 Region: 470-519
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000119
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1017-1088
Classification Level Classification E-value
Superfamily E set domains 0.0000000336
Family Other IPT/TIG domains 0.069
Further Details:      
 
Domain Number 7 Region: 785-820
Classification Level Classification E-value
Superfamily Plexin repeat 0.000068
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 1156-1233
Classification Level Classification E-value
Superfamily E set domains 0.0000752
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2U7P2
Sequence length 1882
Comment (tr|H2U7P2|H2U7P2_TAKRU) Plexin A3 {ECO:0000313|Ensembl:ENSTRUP00000032958} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=plxna3 OC=Takifugu.
Sequence
FSTWSWFSTSFLLLLLLLLPLRRVVYKTFDTSLTHLTVHRKTGEVFVGAVNRVLKLSANL
TELRSHMTGPVEDNAKCYPPPSVRACAHRLEWSDNVNKLLLVDYTGNRLVACGSIWQGVC
QFLRLEDLFKLGEPHHRKEHYLSGAREADGMAGWSFDGLAPTLWQVFIARTVLERMTGQV
TPRVRNRRGAAVASSSGLPSMIKIPSDTLSLYPAFDIYYVYGFSSRTYVYFLTLQLDTQL
TQMDAGGEKFFTSKIVRMCSNDTDFYSYVEFPLGCTKDGVEYRLVQAAYKQKPGRRLAQA
LGLSEEETVLCLFTLHDINLAMRERIRSCYRGEGRNGISICCIQYVYHGRCVHLHFEPKK
IGDDFCGLVLNQPLGGLRVIEGNPLYEDRTEGMGAVAAYTYGEHTVVFVGTRSGQLKKPF
ILESKSRVYRGREREPPPPLIPPGLSYSPDHQYIYLLSDRQVSRLPVESCEQYTSCSDCL
GSGDPHCGWCVLFNMCSRQEACEKWEEPQHFNNKLDQCVDISVTPSNMSVTSPSTELTVR
VQNVPALSGGVSCVFDDLSETPGEVLAKGQVVCMSPSLRELPVHTQSYAEQRVVQLSLRS
TETGHQFISTSFIYYNCSVLNSLSLSLRCTSCVSSVFPCHWCKYRHICTNNLQDCSFQED
ALISSEILQVIVMGLDKGCPQILPTSDILVPAGMVRPITLRARNLPQPQSGQKNYECVFN
IQGKVQRIPAVRFNSSCIQCQNTSYWYEGDESGDLPVDFSIVWDGDFFIDKPMSMKALLY
KCEAQRSSCGQCLKAPPAFECGWCVETRKCLLRQHCPTPEQSWMHHGRHNLRCSHPRITK
ISPLTGPREGGTRVTIEGENLGLQVKEITHVQVAGVRCSSVPSQYISAERIVCDMAEALL
PHSPGGPVELCIGVCSAEFRTLSSQTYSFVSPSFSRVHPEKGPVSGGTRLTITGRHLDAG
STVSVYINKEECLFVKRTNREIICITPASSSGSGPASIRLMIDKAEVTSSETKYVYTEDP
TIISIEPNWTILNGSTMITVTGTNLLTIQEPKVRAKIITSKKKKSFPVVVAQNDHTMTCL
APGNTHGSASHTIFSLCSKSRILDLIWDPTHICIYPLVYGLVIFVAPKVSSLLVLNSTPF
THYPNPIFDPLGNSGILEVKPGSPIILKGKNLIPPAPGNNRLNYTVLIGESPCLLTVSES
QLLCDSPDLTGEHRVLILVGGLEYSPGMLHIYSDSALTLPAIIGIGAGGGVLFIAIIAVL
IAYKRKTRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIQELTNDMDGVKIPFLEY
CTYTMRVMFPGIEEHPVLKELDYICGPGHFLPNVEKALRLFSQLLNNKIFLLTFIHTLEA
QRSFSMRDRGNVASLLMAALQGRMEYATVVLKQLLADLIEKNLENRNHPKLLLRRTESVA
EKMLTNWFTFLLHRFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQ
IDYKQLTLMCIPPEGEAGTEVPVKVLNCDTVTQVKDKLLDAVYKGIPFSQRPQADDMDLE
WRQGRLTRIILQDEDVTTKIESDWKRLNTLAHYQVTDGSLVALVQKQVSAYNIANSFTFT
RSLSNLRSRAPMITPDQETGTKLWHLVKNHEHSDQREGDRGSKMVSEIYLTRLLATKGTL
QKFVDDLFETVFSTAHRGSALPLAIKYMFDFLDEQADKRQISDPDVRHTWKSNCLPLRFW
VNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYK
SWVERYYRDIAKMPSISDQDMDAYLVEQSRLHGNEFNTLSALSELYFYINKYKEEILTAL
DRDGYCRKHKLRHKLEQAINLM
Download sequence
Identical sequences H2U7P2
ENSTRUP00000032958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]