SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2U8U6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2U8U6
Domain Number 1 Region: 32-268
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.03e-41
Family Carboxylesterase 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2U8U6
Sequence length 285
Comment (tr|H2U8U6|H2U8U6_TAKRU) N-formylkynurenine formamidase {ECO:0000256|HAMAP-Rule:MF_03014} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=AFMID OC=Takifugu.
Sequence
QELDRQYSPSRWSHRMSADDVIQAHVKALKEGTVRARSLAQTLLNVPYGEGDGEKLDVYI
PSTSSLDVDLVIYLHGGYWQFLSKEESGFMAVPLVDKGVVVVAVDYDIAPKGNMDLIVSQ
VRRSVVSVVQQYSHISGLYLCGHSAGAHLAAMVLSTDWSQYSVTPQIKGALLVSGIYDLL
PILSTYVNDPLKMTEEVALRNSPSKFVSQLKHSSSDCHIIMAVAENDSPEFHKQSEEYYK
ALEASGLNVSMENVANTDHFNIIEQLVDEEYHLTKLLLKMMGKGI
Download sequence
Identical sequences H2U8U6
31033.ENSTRUP00000033362 ENSTRUP00000033362 ENSTRUP00000033362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]