SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UAG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UAG5
Domain Number 1 Region: 132-379
Classification Level Classification E-value
Superfamily vWA-like 7.56e-83
Family Integrin A (or I) domain 0.00000000529
Further Details:      
 
Domain Number 2 Region: 374-464
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-30
Family Integrin domains 0.0000151
Further Details:      
 
Domain Number 3 Region: 635-719
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.28e-24
Family Integrin beta tail domain 0.0000256
Further Details:      
 
Domain Number 4 Region: 24-82
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000235
Family Plexin repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 593-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family Integrin beta EGF-like domains 0.00098
Further Details:      
 
Domain Number 6 Region: 551-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Integrin beta EGF-like domains 0.0097
Further Details:      
 
Weak hits

Sequence:  H2UAG5
Domain Number - Region: 520-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2UAG5
Sequence length 791
Comment (tr|H2UAG5|H2UAG5_TAKRU) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=itgb3 OC=Takifugu.
Sequence
MSGFNKISPLLIRVLTIRDASGSSNVCTTRGASTCKECLAVHPSCAWCLQEDFGLGVASS
PRCDLKRNLVAAGCTPSAVESPTSKLQVMEDRPLSNKATVATQDITQIKPQRLHINLRPD
DAKRFTVKVRQVEDYPVDLYYLMDLSYSMNDDLFRLRSLGKGLAEAMNRTTSNLRMGFGA
FVDKPLSPYMYISPKEAVKNPCYSINMTCLPQFGYKHVLTLTEEVSRFTEEVKKQMVSRN
RDAPEGGFDAIIQAAVCKKKIGWRPGASHLLIFTSDAKTHVALDGRLAGIVQPNDGKCHL
NAENMYSMSTTMDYPSLALITEKMSENNINLIFAVTNPVVPLYQNYSELIPGTTVGTLNN
DSGNVIQLILQAYAKIRSKVELELQGVPDGLSLSFNATCLNGELIPGLRSCSGLKIGDTV
SFTVEARARGCPKEKKKTFFIKPVGFKDTLSITVTFECDCKCQAKAQPSSPKCNHGNGTY
ECGICMCHPGRLGPHCECAEGDYDPTEQDSCSGPTGSGGRGSICSGRGDCVCGQCVCHSS
DFGKVWGKLCECDDFNCLHYKGELCSGHGVCNCGFCQCAPDWQGENCNCSRRTDTCMSSM
GLLCSGRGQCVCGACECTQPGAYGATCDKCPTCPDACTMKKECVECKHFKRGKLFQDNTC
SRICKDEIVLVDELGSGVTNAVNCSYKDEDDCVERFQYYEEASGKSILYVVKEPDCPKGA
DILVVLLSVAGAILFLGLAALLIWKLLITIHDRREFAKFEEERARAKWDTGHNPLYKEVT
STFTNITFRGK
Download sequence
Identical sequences H2UAG5
ENSTRUP00000033932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]