SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UGP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UGP3
Domain Number 1 Region: 448-554
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.2e-28
Family PDI-like 0.01
Further Details:      
 
Domain Number 2 Region: 553-666
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.98e-27
Family PDI-like 0.021
Further Details:      
 
Domain Number 3 Region: 82-230
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.04e-26
Family PDI-like 0.025
Further Details:      
 
Domain Number 4 Region: 23-103
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.94e-25
Family Chaperone J-domain 0.00018
Further Details:      
 
Domain Number 5 Region: 668-770
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.53e-24
Family PDI-like 0.03
Further Details:      
 
Domain Number 6 Region: 350-443
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000612
Family PDI-like 0.02
Further Details:      
 
Weak hits

Sequence:  H2UGP3
Domain Number - Region: 233-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000131
Family PDI-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2UGP3
Sequence length 791
Comment (tr|H2UGP3|H2UGP3_TAKRU) DnaJ (Hsp40) homolog, subfamily C, member 10 {ECO:0000313|Ensembl:ENSTRUP00000036114} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=dnajc10 OC=Takifugu.
Sequence
RHVWIKKHDDHASIIKHLTLMILVVLLNAVWAESQDYYELLGVSKEANTREIRQAFKKLA
LTMHPDKNPNDPEAHDRFLKVNRAYEVLKDEDLRKKYDKYGEKGFDDHKQGGQYESWNYY
RYDFGIYDDDLEIITLDRGDFEAAVNSGEVWFINFYSPRCSHCHQLAPTWRDFAKEMDGV
IRIGAVNCGDNHHLCRSKGINSYPSLFIYRAGQRPEKFSGDRSKDNLVRFSMQFITTTVT
QLWQGNVFKEIENAFSLGLGWLITFCFDTGDCLEPRTRQKLGGMLDGLIKVGWMDCAMEL
QLCGSFQVTSAATVFFPPGSSIDQPGSVLWLNTLDSKEIYSQVLDHLPDLQLLTSDNFES
QLAHHRWLISFTFGDRSPASNEYKKLQAFLRKDHIQVSRVDCTADSKLCQSLYIYKPCIA
VFKGLGIHDFEIHHGKDVLYNIVSFARDSVHAHVTTLRPDNFPADRKEPWLVDFFAPWCP
PCQALLPELRKASIQLVGHMKFGTLDCTIHQGLCSRYNIQAYPTTVIFNGSSVHEYEGHH
SADGILEFIEDLVNPSVVSLDPSSFSEKVKGRATDQAWVVDFYAPWCGPCQALLPEWRRM
ARLLLGQVLVGSVDCQRYQSLCQNQNVRAYPEIRLYSSNMKPDHYMSYSGWHRDAHSLRA
WVLRALPSVSVDLTPQSFRSQVLLGQDHWVLDFYAPWCGPCQQFAPEFELLARILKGKVR
AGKIDCQAHQHTCQSAGISSYPTVRFYPYLGTRRHEQSGEYINSRDANTIAYTIGQRLHH
LLPQPQNKPKV
Download sequence
Identical sequences H2UGP3
ENSTRUP00000036114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]