SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UGR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UGR6
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000873
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2UGR6
Sequence length 75
Comment (tr|H2UGR6|H2UGR6_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000036137} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
MDQELTEEELQDLYAWLDKIPLSRPKRHITRDFSDGVLAAEVVKHFLPKLVDLHNYTPAN
STQQKLTNWDVLNRR
Download sequence
Identical sequences H2UGR6
ENSTRUP00000036137 ENSTRUP00000036137 31033.ENSTRUP00000036137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]