SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UGS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UGS2
Domain Number 1 Region: 440-575
Classification Level Classification E-value
Superfamily TIMP-like 1.18e-26
Family Netrin-like domain (NTR/C345C module) 0.023
Further Details:      
 
Domain Number 2 Region: 215-311
Classification Level Classification E-value
Superfamily Immunoglobulin 9.62e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 393-447
Classification Level Classification E-value
Superfamily BPTI-like 4.54e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.003
Further Details:      
 
Domain Number 4 Region: 330-388
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000894
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.026
Further Details:      
 
Domain Number 5 Region: 131-183
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000374
Family Ovomucoid domain III-like 0.031
Further Details:      
 
Domain Number 6 Region: 41-87
Classification Level Classification E-value
Superfamily Elafin-like 0.00000144
Family Elafin-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2UGS2
Sequence length 577
Comment (tr|H2UGS2|H2UGS2_TAKRU) WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 {ECO:0000313|Ensembl:ENSTRUP00000036143} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=wfikkn1 OC=Takifugu.
Sequence
QQLLKCRRIAREAQWIRAYFFILFINDLPELSLCASVAASKVEHEGFCPNKLNSNLWVDA
QSTCEKECNVDEDCADFEKCCTNVCGLNSCVAARFPDGAAALPDGQSGGNGSDAHSSVAT
CEGFVCSQQGAVCDIWDGQPICKCQDRCEKEPNFTCASDGLTYFNRCYMDAEACIRGVTL
TVITCRFYLAGPPTSPLPQDTTANPTPTSSLEDPMPPTLYSNPHHQSIYVGGTVSFHCDI
VGVPRPDVTWEKQSELRERLVMRPDQMYGNVVITNIGQLVVYNAQVWDTGVYTCIARNSV
GVLRADYPLSVIRRGEDDFSEDPELPMGRPFSPADCLAEVDQRACSGERHVDWYYDSSLG
SCMAFSNGGCDDSRNRFETYEECKASCQREGMGICSLPAVQGPCKAWEARWAWNSVMKEC
QAFAYGGCHGNANSFHTKKECEANCPQPKRKPCKTCRVKGKMIPSLCRSDFAIVGRLTEL
VEDLDSGLARFSLDEVLKDEKMGLTFFNTKHLEVTIAKIDWSCPCPNVTVEENPLLVMGV
VQDGMAIIQSDSYVRTITERRIKRLRDVVNKKTCKAL
Download sequence
Identical sequences H2UGS2
31033.ENSTRUP00000036143 ENSTRUP00000036143 ENSTRUP00000036143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]