SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UK44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UK44
Domain Number 1 Region: 1-456
Classification Level Classification E-value
Superfamily Sema domain 1.31e-106
Family Sema domain 0.0000806
Further Details:      
 
Domain Number 2 Region: 1301-1428,1639-1825
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-46
Family p120GAP domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 902-993
Classification Level Classification E-value
Superfamily E set domains 1.06e-16
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 4 Region: 459-511
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000157
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 990-1075
Classification Level Classification E-value
Superfamily E set domains 0.00000000294
Family E-set domains of sugar-utilizing enzymes 0.06
Further Details:      
 
Domain Number 6 Region: 820-879
Classification Level Classification E-value
Superfamily E set domains 0.000000168
Family Other IPT/TIG domains 0.037
Further Details:      
 
Weak hits

Sequence:  H2UK44
Domain Number - Region: 760-801
Classification Level Classification E-value
Superfamily Plexin repeat 0.00863
Family Plexin repeat 0.0044
Further Details:      
 
Domain Number - Region: 605-642
Classification Level Classification E-value
Superfamily Plexin repeat 0.0157
Family Plexin repeat 0.0048
Further Details:      
 
Domain Number - Region: 1106-1164
Classification Level Classification E-value
Superfamily E set domains 0.0164
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2UK44
Sequence length 1853
Comment (tr|H2UK44|H2UK44_TAKRU) Plexin b1a {ECO:0000313|Ensembl:ENSTRUP00000037315} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
DTEFQHLVLHPDPSMGTVYLGARDRLFQLDASEGLHLKQEESTGPVSDSKDCLPPVTEVN
CPQARKTSNYNKLLLVDPNALELITCGSIHQGTCQKRSLTSIKKIIFSTERPVDTQYVAA
NDPMVSTVGLVVKLNCCEKTVMYVGRGYTASHPPISTRHLSSEPIFSYEETAKLAVTGRL
SEYDHHFVMAFTRHANVYFLFYRRDIKTPLREYRTYAARLCLNDTSYYSYVEVPLVCQSP
STSSSSYNFLQAAQVPGSPKVGRGSGREIDNLLGVFSSNPVSANKNPLDSSALCIYPLDE
LDQHFDSTRDLCYSKGGHVRGKGEVAYIEYEVKSSCANLPLNTVKAYPCGSDHTPSPMAS
RKPQEAKAVLEIFSHHLTAVAVSVRKGHSIAFLGDTKGTLHKVFHPIPIHWQDGEVKVYA
NITIQLNSPINKDLLLDHNGTHIYIMTKNTVQKRPVAECGAHLDCWSCLSAIDPYCGWCV
LQGRCGQHWECQQGSVQGQWIWSFNQTQQCLHIHHLSLYNISLGEKSNVCNVSVKGLPNL
GKGEAYSCFFKDAQTQALFTTSGVICPTPDADSLPPIDHGDEFVVLTLSLRFMNVIVAET
EFTFYNCSLVQQCQGCVSSRWGCNWCIHQHVCTHKQICSKGVTIFNRNKECPSVERVQGS
SLLPVSVERKITLLAKHLNVFQDKSLDYECVLEIENHLLNQVPTKPDYADSTLNCSFSKY
LYSVLMEEYTAMIIVRRKNKFRIDSAEDLYVNLFNCSVGRQDCSRCHTADPKYGCVWCNG
ASASGCVYQGSCNGEVQTTHILYTSSNTKCNPDESWQVHLDPLSGPVEGGTVVTISGSNL
GQRAEDVQNSVTVAGIPCSVINSRYEVSSNVRILCEYGPRILMFHTSIYYRIICLIFMML
HHQNPVLSSISPRRGPRAGGSSITIRGWGLRTGHSSEVSVLIGEVPCMVLNIQEDKIICV
TSGCNRTGDYRVTVHFGGAERHLLGSVYHYTPNPNITMAAPTKSFLSGGRIIRVSGQNLD
VVQEPKMRVILSPPESLYESQCCVNSSTLITCPSPAVGSEARRAKVKVLFLMDSLHFDFT
SVGIDNFNYEPNPKLYPLNRNNPTKPYHHKPGSIISVEGENLDLAIYKHEVQALIGEGVC
SVKTLTHNNLYCEPPVQQPSIDVKMGNLNFSLGRVKYDSQAPSIFPVEAQVGVGVGASIV
ALIVLIIVLIYRRKSKQAMRDYKKVQIQLENLETSVRDRCKKEFTDLMTEMMDMSSDLVG
SGIPFLDYRAYIERIFFPSHQESPLRRNLDVPENRRQTVEQGLVQLSNLLNSKLFLTKFI
HTLEVQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLNDLVEQYVAKNPKLMLRRTE
SVVEKLLTNWMSVCLFTFLQESAGESFYMLFRAIKHQVDKGPVDVVTGKAKYTLNDNRLL
REDVEYRTLTLNVVIPAAATCTGATSQIVPAKVLDCDTITQVKEKLVEQTWKGTSFSQRP
HIDSLQLEWRAGVAGHLILSDEDLTSVVQGSWKRLNTLQHYKVSESNTETHLLKKTLLNC
STILLKTSQNGQEMKLFHFVSCCDSLEPIPSETPALDDGEEEGVRLWHLVKAREESELPK
HRKGSVRERGGERAKAIPEIYLTRLLFMKGTLQKFVDDLFTAILSTSRPVPLAVKYFFDL
LDEQALQHGITDPEIIHIWKTNSLPLRFWINILKNPQFIFDVQTSDHVDAVLSVIAQTFM
DSCTIADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTIPASDQEMNSSLAEISRN
YTADINCLVALHDLYKYINKYYDQIITTLEEDTTAQKMQLGYRLQQIAAAVEN
Download sequence
Identical sequences H2UK44
ENSTRUP00000037315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]