SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UM25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UM25
Domain Number 1 Region: 748-994
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-61
Family Nuclear receptor ligand-binding domain 0.0000000784
Further Details:      
 
Domain Number 2 Region: 614-691
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-25
Family Nuclear receptor 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2UM25
Sequence length 996
Comment (tr|H2UM25|H2UM25_TAKRU) Nuclear receptor subfamily 3, group C, member 2 {ECO:0000313|Ensembl:ENSTRUP00000037996} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=nr3c2 OC=Takifugu.
Sequence
METKRYQSYFDGCDTENRWSQVSGTMDSCSTEESSLTGSDILMDIANVSCSAESPATDRS
TKKQEQPMLQLSQNQPFLLPHFNNTLHGHKQEMDSKELSKTVAESMGLYMNAAREADFAF
SQHGGSASPGKMYSVCGRSLEEAQSGFTKSFKLKPFGFQQCNTTPRECTIGTTVSSASVL
VPSISCSPQTPSSISSPGGSNNMVSSTTSPPMCFGPMCSSVSSPVSQTSCASTLPNIKRR
NSATCSPVESSTVGSPPLTSPLNIMRSPISSPQSMSSVRSPPSCSTTSNIRSSVSSPTGA
NCTSTANNCNTARPSISSPAIGGTVASSSPRNASVGSFPVSSPAGGLGLVQNDTNSPEAA
GLTRDADFKNFEFPKVEMVDGELFSVGVDHMGMVKYIKNEPGSDFRSMCLESSKCNASST
PFITQIKSEPNKNDGCMNQQPYSEPSQSLSLFPSSETTYLSLRNNIDEYSLSGILGTPVS
SLNGNYESDVFSNSVLSKGVKQESPDGSYYQENNSMPTSAIVGVNSSGHSFHYQIGAQGT
MAFTRHDVRDQSNPLLNLISPVTALMESWKSRPGMSQGSLSGRGEGYPGQNCIPERVTGA
SVHSSPLRQPTSTAKVCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCI
IDKIRRKNCPACRVRKCFQAGMNLGARKSKKLGKLKAVSDELPGSKDAHTSTGGVSGAYV
PSEKELNASPASALVPHGPGVVTPFLPPSICSVLELIEPEEVYSGYDNTQPDTTDHLLSS
LNRLAGKQMVRMVKWAKVLPGFRGLPIEDQITLIQYSWMCLSSFCLSWRSYKHTNGQMLY
FAPDLIFNEERMRQSAMYDLCLGMRQVSQEFLRLQLTYDEFLSMKVLLLLSTVPKEGLKN
QAAFEEMRLNYVKELRRSVGKATNNSGQTWQRFFQLTKLLDAMHDLVGNLLDFCFYTFRE
SQALKVEFPEMLVEIISDQIPKVESGLTHTIYFHKK
Download sequence
Identical sequences H2UM25
ENSTRUP00000037996 ENSTRUP00000037996 31033.ENSTRUP00000037996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]