SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UNC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UNC0
Domain Number 1 Region: 131-375
Classification Level Classification E-value
Superfamily vWA-like 2.86e-79
Family Integrin A (or I) domain 0.00000045
Further Details:      
 
Domain Number 2 Region: 376-460
Classification Level Classification E-value
Superfamily Integrin domains 2.98e-24
Family Integrin domains 0.002
Further Details:      
 
Domain Number 3 Region: 621-702
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000536
Family Integrin beta tail domain 0.0015
Further Details:      
 
Domain Number 4 Region: 25-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000023
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Integrin beta EGF-like domains 0.007
Further Details:      
 
Domain Number 6 Region: 506-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Weak hits

Sequence:  H2UNC0
Domain Number - Region: 579-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family Integrin beta EGF-like domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2UNC0
Sequence length 774
Comment (tr|H2UNC0|H2UNC0_TAKRU) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=itgb2 OC=Takifugu.
Sequence
MGLYQVFFLFLLIVFLCPGLCQVGGSCSKTVVNSCSDCIRSGPDCAWCMQENFTQPGEQE
TVRCNTRALLTERGCEPQKIIAPRNKVRVVKKLPLSESFEKQEPIQLSPQVIRLKVRPGS
PATFRVSFKRVQGYPVDLYYLMDLSNSMKDDLDNVKDLGNDLLSALKTITAHAQIGFGAF
VDKTVLPYTNTNKKKLLRPCDDDSEKCQAAFGYRHVLNLTPREQEFKQSVTNQFISGNLD
SPEGGLDAMMQAAVCGGAIGWRNSSTRLIVLTTDAGFHMAGDGKLAGILEPNDQQCHMKD
NLYYKSNEMDYPSVGQLAFQLEKNNIQTIFAVTENVQAIYKQLSAIVPKSEVGVLSNDSN
NVVELIKTAYRKLSSKITLTHDRLPDNVQITYTPECQSAGPPGPDEGVCDNVKEKQEVSF
NVTVVVDSCIKDTSFTIRILGIKDTLTVNLSTNCECNCNDPQDSQHQSCGGKGSLTCGVC
SCQEGFIGRICECAIGKEDKDTLRKACLNADGVECGGRGECVCGRCQCHGNYHGDHCECD
DEHCEKFQNQLCGGNGKCKCGVCSCNEGYEGSACQCKVSQTECKPPNGTVCHGRGVCRCS
RCECDAGYQRPHCKTCLGCPDPCQTKLNCIECLGFNIGPFKGNCSKACSTVVPNMVSQLN
KKGKQCELKDSESCWIKFSLEQLDGVDTYKAEIQSERVCPEPPSVTAIIGAAIGSVALIG
ILLLMLIKFFIYMKDVKEFRKFEKEKKKSKWTDGANPLFKNATTTTTNPIFTGE
Download sequence
Identical sequences H2UNC0
ENSTRUP00000038441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]