SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UNN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UNN5
Domain Number 1 Region: 279-367
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.22e-31
Family Small-conductance potassium channel 0.00011
Further Details:      
 
Domain Number 2 Region: 149-319
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-23
Family Voltage-gated potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2UNN5
Sequence length 420
Comment (tr|H2UNN5|H2UNN5_TAKRU) Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4 {ECO:0000313|Ensembl:ENSTRUP00000038556} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
YRLRDRKFLLEDKKRLCALALGTAVLGIVLMIVHAETCPFIDKTASHVFNCSISLSTACL
LVLIIAFHYKDIRLFIIDHNQVDWRIAMTSQRVLVITLELIVCVIHPIGTYRELSQHLNS
SSPAPLCISNHRGEAFMDLELLLSMLMFLRLYLVHRTILLHSKVLLSASYRSIGSLNNIN
FTFRFVLKVLMNKYPGRTLLIFIIFFWLTASWMLTLCERKTIEVTGKMDTALWLVAITFL
TVGYGDVSPQTTCGKAVCLFTGVMGVACTAMLVAVVTKTLELNKGEKHVHLFMLDIQISK
RIRHAAANVLRECWLLHRTNLKRGNRGEHRRHQRCLLEAIRVFRHLRLKQRKLRDYVSEM
VDLPKMQMIMCDLSANWNNSYRELEQRILSMEQKLDELSRCFHQTSELLSQVLLRRNPEI
Download sequence
Identical sequences H2UNN5
ENSTRUP00000038556 31033.ENSTRUP00000038556 ENSTRUP00000038556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]