SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UNU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UNU1
Domain Number 1 Region: 222-315
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000741
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 2 Region: 106-170
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000326
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2UNU1
Sequence length 609
Comment (tr|H2UNU1|H2UNU1_TAKRU) KH domain containing 4, pre-mRNA splicing factor {ECO:0000313|Ensembl:ENSTRUP00000038612} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=KHDC4 OC=Takifugu.
Sequence
ISLNSLWRSPSRRSKWDQPGPGSGGTGEAEAAPTGALDAAAAVAAKINAMLVAKGKLKPS
QIGTPGLPERVISVGKPPVAPKAKDDLVVAEVEINDVPITCRNLLTRGQTQDEISKVSGA
AVSTRGRYMAAEEKTKALPGDRPLYLHVQGQTRQLVDRAVNRIKEIITNGVVKAATASSS
ASSFSPGAASVTVYQQHSPGPPTLPPMSQHKSHFQSGMHYVQDKIFVGLEHAVPGFVVKE
RVEGPGCSYLQHIQAETGAKVFLRGKGSGCLEPASGREAFEPMYIYISHPKAEGLAAAKT
LCENLLQTVHAEYSRFLSQMNTMMPSQQGFAQPPAVNGISPQPPYYPTTGYQSGYPLPVP
PPQPQSVPPPYTVPALVPPAAPLGVPPQYPLPPTQTTAPTPVPAPALVPVPAVAAGPMPQ
TLPPASFPPTSTVPPKAPPPANPANPPQKRRFTEEVPDEKNSNLLGYQHGPIHMTNLGAG
FSVDSSESAGPTLPSSSGPLSERDNRQLMPPPSLPVNGARPRMEERGTAQGPVEPAVKRL
KTGLVAYSGDSSDEEEDHCSSKPSGPGNPGAAPLPPSSGWIQGYHCPPPQSSRSKTQPPS
QTIPFWMAP
Download sequence
Identical sequences H2UNU1
ENSTRUP00000038612 31033.ENSTRUP00000038612 ENSTRUP00000038612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]