SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UR85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UR85
Domain Number 1 Region: 235-343
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-25
Family SH2 domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 347-384
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000327
Family SOCS box-like 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2UR85
Sequence length 385
Comment (tr|H2UR85|H2UR85_TAKRU) Suppressor of cytokine signaling 4 {ECO:0000313|Ensembl:ENSTRUP00000039458} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=socs4 OC=Takifugu.
Sequence
TNMSEKKPKGSGTRPKCGFRSWSADSYIWRSKKRSRNGSTPSGLDSEGTEELGGRSTSCP
RRRRERMCSCTTLGDGPASADNDVVCRKALSRRSLRQKFQDAMGQCLPLRSHHHIHHHHP
PSSSRPFSVLFWSKRKIHVSELMQEKCPFSPKSELARCWHLIKKYAAHPTAMKDMEAPLK
PSVSSSSTSPPQTPLSWDDICCSPGPGNTSLEDWDPSCPHGGAEGRCNHTDYILVPDLLQ
ISNSPCYWGVLNRFEAEELLEGKPEGTFLLRDSAQDEYLFSVSFRRYSRSLHARIEQNDK
RFSFDVHDPCVYQDSSVTGLLRHYSDPATCLFFEPLLSSPLSRTFPFSLQHLCRTLICSR
TTYQGVESLPLPPQLRDYLRQYHIK
Download sequence
Identical sequences H2UR85
31033.ENSTRUP00000039458 ENSTRUP00000039458 ENSTRUP00000039458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]