SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2USG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2USG3
Domain Number 1 Region: 80-161
Classification Level Classification E-value
Superfamily Virus ectodomain 8.89e-20
Family Virus ectodomain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2USG3
Sequence length 272
Comment (tr|H2USG3|H2USG3_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000039886} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
WWLCGHNAYAHLPANWSGVCAPVHLKDHTIIIYANNTENIAHKRFKRDLNEYEFKPHDSV
WGTDVPQEFKHWTDGQKVSISLFPWVGVAKNILRLETVDYRLKVFTNLTKVALTGVKEEM
TALRLMAMQNRMALDLITAPQGGVCAMVGDYCCTFIPENDADGHLIDSALRNLTKLQKAM
IDDGSPPPDWLTKMLSGWRKLLFKIGIMIGIVLLVLAILACCVVPLVRGCIGRLVGSAVT
STLLQVEEQSLLDDDEEESEEEWINVIQDVKE
Download sequence
Identical sequences H2USG3
ENSTRUP00000039886 31033.ENSTRUP00000039886 ENSTRUP00000039886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]