SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UTQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UTQ3
Domain Number 1 Region: 346-445
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.43e-30
Family Ras-binding domain, RBD 0.0034
Further Details:      
 
Domain Number 2 Region: 479-591
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-17
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2UTQ3
Sequence length 1346
Comment (tr|H2UTQ3|H2UTQ3_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000040327} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
MDQLSDEEVDIREEEEEEDSDKEDQDLDQMFGAWLGELDKLTQSVKSLDDGRPAQPQSQQ
KAPLRQETNMANFSYRFSIYNINEALNQGENVDLDALMADLSSIEQELSTINSKPNSSMA
RLGLTDTKVRQKPPAGRSSKQQQPGGGSSAATGHHGKPALASNFSLDDITAQLEKASLSM
DEAARQTSSHSLSSASSTSATVRRSGSSQRQHRRTGSVGTVSEHEVCTFIHSSRSSITSA
SGISVNSASSMDSLDSQHVTRPQQENVCEPFQNFVDFCIHLSSTQMLFHIFLSALMIILP
QHSYLDKETFLILRNIAGKPSHLLTQEHEEQAAKLKAENIRVALEKIKEAQVKKLVIRVH
LSDESSKTMMVDERQTVRQVLDSLLEKSHSGYSADWSLVETLSELQMERIFEDHENLVEN
LLNWTRDSQNRLMFTERIEKYAVFKNPQQQNYLLGRKETCEMTERNKEALLEECFGGSSV
SVPEMEGLLWLKEDGKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQLDHVNVYLGQ
DYKSKYKAPTDYCMVLKHPQIQKKSQYIKYLCCDDIRTLQQWINSIRIAKYGKQLYINFQ
DAMRKTEAAYDWSSLSSSSIKSGSSSSSLPESQSNHSSQSDSGVSEMASAGHTRSQSVVS
SIFSDAWRRGTQGERSKMMKIDAISRPIPVQMPSVSPQPVLLSQPQNSYPDGLDPSEDSP
SPPSPPPPPAVVSVAAASYIKYSTLARLQNQNQPESSMIPPSPHPPSAEQTPDIMACLSN
PSTLPPPPPPPPPPEPDLTSCPQLSNAGLQQFLAKKFPNMAYDFTPPAGEDTCPPPPPLS
DASPLASWPPSHNAPPPAPPKTFTGGLPPQTAPKPSGPSSLPVALSPVSPSEIFGSHVPI
KKQQSFSTGHSPNQPPPTLPKQHSLSSKNLALSPSSSSTSIAAATSSLVKQIVNQFPGNS
APCSLSASNSMEGSKLSAPQSPPAVKSKPKWQPGGAPQSPEFPPPPPDTSAEDFPPPPVS
SSSKTGSPIKKSPSTSSTGSTKRGPPPTPQRASSIRTGSPSEGQDEKPKKVESLVSKFGS
SSRSNSLTNDPSGLPAPLPKPGKLNLANLPLALQGLQASHQSTEFPSPPPPPPPSQHPQI
DSSPDFFPPPPSDSELFPPPPHLSEIHQPPKVAVVNPQPQSWKQSSLKKGAVLPPATNRR
PSNPAQYDQMTSKPLSPPPLSQTPPPSLPSFSSSSSPVPPTSPKSPGPSSLALKPLFLED
LNRTLKRKSISRHGSLTSSHLISSKMEPVGTMDDMALLPPPPPELLQQQQQQSAKHANIS
GYATLRRGPPPAPPKRDQSTKLTSEW
Download sequence
Identical sequences H2UTQ3
ENSTRUP00000040327 ENSTRUP00000040327 31033.ENSTRUP00000040327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]