SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UTQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UTQ6
Domain Number 1 Region: 7-485
Classification Level Classification E-value
Superfamily Sema domain 1.31e-174
Family Sema domain 0.00000000011
Further Details:      
 
Domain Number 2 Region: 481-532
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000011
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 547-628
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000565
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2UTQ6
Sequence length 718
Comment (tr|H2UTQ6|H2UTQ6_TAKRU) Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Ga {ECO:0000313|Ensembl:ENSTRUP00000040330} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101071870 OC=Takifugu.
Sequence
ELTDTKTARPFSFSFNTSDYRILLMDQDQGRLYLGSREYLVALDMHNVNKEPLIIHWPAS
AKRKGECQMTGKGRQGECANFVRLIEPWNRTHLYTCGTGAYQPICTFINRGWRAEDYLFR
LVPGFVESGKGKCSYDPKQENIAVLLNGNLYAGVHIDFMSTDAALFRTMGGRTAIRTEQY
DSRWLNEPVFVQIQQIPDSAERNDDKLYFFFREKSLDSSGGASPSILARVGRVCLNDEGG
QKSLVNRWTTFLKARLICSVIGEDGVETRFDELRDVFIQPTQDERNPLVYAVFTTAGSVF
KGSAVCVYSMADIRNVFNGPFAHKHGHNYQWTEYTGKIPYPRPGTCPGGTFTPGIPSSKS
FSDEAVNFIRSHPLMFHPVYPTHRRPLVVRTGVDYRFTALVVDQVDAVDGRYEVLFLGTD
QGTVQKVIVLPKDPTTMEELTLEEVEVFRSKAAVKTMKISSKRQQLYVSSDAGLTQVSLH
RCSVYGRACSDCCLARDPYCAWDGESCSAFTPSTKRRSRRQDVRHGDPLRQCRGFNAKVE
KRLRETVQFGVEGSGTFLECQPRSPQASVKWLFQGEGKRKLVGRAGGVLKTDHGILLKSL
NQSDAGLYHCLATENNFKHTVARVALRVLDRDIVLALTAQDDEDEEPETHQPGPYPPPSV
ASTPFPPEIRLINQYCQSYWDQMAVGEEPGCRRREEGALMRVLVEVAAEDRFCQWEEG
Download sequence
Identical sequences H2UTQ6
ENSTRUP00000040330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]