SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UU03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UU03
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.67e-32
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 
Weak hits

Sequence:  H2UU03
Domain Number - Region: 1725-1753
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0745
Family Mitotic arrest deficient-like 1, Mad1 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2UU03
Sequence length 2284
Comment (tr|H2UU03|H2UU03_TAKRU) Neuron navigator 2a {ECO:0000313|Ensembl:ENSTRUP00000040427} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
QIYTDWANHYLAKSGHKRLIKDLQTDVTDGVLLAEIIQVVANEKIDDINGCPKSRSQMIE
NIDACLTFLAAKGINTQGLSAEEIRNGNLKAILGLFFSLSRFKQQQQQAQRQNSQPYLPQ
SSHPPLSHQSSSPAQLGHAPHGTSATAAQDGSQSKLLKFSLGQKKTSRLPGPSARVSTAG
SDVPSRGSISAAGNRRSQGFSDKTKTSSHSSRVSADKENGASISAATSGLISPPSSSSSS
SSTTAIPQPNSNGKPWRSKSMSSKHAASSAPSSTMLSVKQEKEASGKAAVAGEAPKAATQ
KSMLEKLKLFNSKGGSKSSSSNGIGAQTDHAGLAKQPGAGQVERAETGSNTDPLETASSP
KIALRGIAQRTFSRALTAKKGSVKGSDKDKEKGKEKVKGEEPKEEVAPAALDTDSSTKRT
SKITSFIPKGGKVTKKDTSTPAHSGIPKPGGKAQGVAAKASSAKETGERPRSMRLVGGLS
THRGPLDRDRDSRHSSSTSSLASTEGKSSAAPVAGGGTTQSTASNTISVQLPQNQQHHSH
PNMATVAPFMYRSQIDGEGTPNEETGTGGLGGDVSLTKNSQLSTEDLSGEDPETRRLRTV
KNIADLRQNLEETMSSLRGTQVTHSTLETTFDGTVTTDISSTGGTVTNSGGSSRSILSLT
SSRPSLSSWRLGQSSPRLQAGDAPSMANSYGGRVAGSQGGRYLYPGHLRRQLAARGGGLC
SLDLGDRTGEDIDMEGMEVTGYMSDGDVLSKNITRTDDVSSGYMTDGGLGLYTRRLNRLP
DTMASVRETVHRNASSGQGDGDSWDDSSSVSSGISDNIDTDDINTSSSISSYANTPAAQR
KGLSTQPVTDAEKHSASTAGHQAWSGDEVKRADSGSDNGVRMESASSWTRRTPSDVSEES
DKGSSGRKITSVSHTGSWRRGMTAQVGITSPRTKSTSSTGSTGCKTDDIKVSEKGRRSPR
ANGLHRSPSDAGRSSGDEAKKQTHMLTSRTPTSTFGFKKPCPGMVAMVTASGATITSGSA
TLGKLPKSGGRSLTVGLKTGGLDGGSTLGHHDDSFLPMSARSTLQYRSLPRPSRSGAAAR
NGNRSSTSSIEAAVLSVTSQAKNPLSVSKVNGSGLLANQTDREKGVTDIDNLRGGGAATV
PLPGRQQVSSPTLRRLFGGKTSKQAPVTTAENMKNSTVISNPHAALNHVTTVLESPDGGV
GGVDSETNSPLFGGRVHVSGMGTLGSEQASSPGSVYSSTGPSNSLTWGTTFSSSSAQSRE
STLGGHSGAGSMGYPSVSSMHTSSESIDMSLGSAGHGTHKEENLSALGRTSSVKTGASES
GPHCGRNTLPKKGLRYGPSPQLRGHEESRDWLRSHSTSGLQDSANNSPFSPSLTSPSGTR
FNFGQLASSPTSTGQMNLTGLRNNSLSNQDVPFDPCSDSRLRNSCMSLDEKTRTMSRSGS
FRDGFEEVHGSSLSLVSSTSSIYSTNEEKSQSEQIRKLRRELDASQEKVSALTTQLSANA
HLVAAFEQSLGNMTIRLKSLTLTAEQKDSELNDLRKTIELLKKQNAVAQAAINGVINTPE
LVLKPDLRIRRQHSSDSVSSINSATSHSSVGSNMDADAKNKKKNKKNWASFTGDKLRSSF
KQAFSKKKSPKSASSHSDIEEMTDSSLPASPKLPHNGTGASGQMLRNTHSMCVNLKTARR
CLDRLSECLDSEAETVMQLRSELREKEMKLTDIRLEALSSAHQLDQLREAMNRMQLEIEK
LKAENDRLKVENQGSRTGSQVSISSSPPPHAHSQVPGTGPGLPQHSLNLTTSESTSLGSD
MLLDDTGGEGGMRKEGRHVKMVVSLDEDSKWTEEGRPRHFLIGCIGVSGKTKWDVLDGVV
RRLFKEYITHVDPMTQLGLSSDSVEGYKIGEIHRPSSTSAAHMPELLPCGYLVGDSNTIN
IQLKGVSSDNVDSLAFDTLIPKPMLLRYVSLLKEHRRVILSGPSGTARPTCQSVISTLAL
TPHAVVTFNVDHKSGKELRQYLSGLAEQCSGVPGAESPLVVILDNLHHVSSLGEIFNGIF
NCSYQHCPYIIGTMSQATSSAPNLQLHHNFRWVLCANHMEPVKGFLGRYLRRKLIEMEIS
SRTRSLELVKIIDWIPRVWHHLNRFLETHSSSDVTIGPRLFLSCPMDVEGSRVWFTDLWN
YSIIPYMLEAVREGLQLYGRRAVWEDPAAWVIDTYPWSASPALTEWPPLLQLRPEDVGFD
GYSAPREGVRKELPQSDSDADPLMNMLMRLKEAATSSSPQSYDSDSNSNSHQDDILDSSL
ESTL
Download sequence
Identical sequences H2UU03
31033.ENSTRUP00000040427 ENSTRUP00000040427 ENSTRUP00000040427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]