SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UXH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UXH3
Domain Number 1 Region: 138-385
Classification Level Classification E-value
Superfamily vWA-like 7.34e-80
Family Integrin A (or I) domain 0.0000000117
Further Details:      
 
Domain Number 2 Region: 380-470
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-29
Family Integrin domains 0.0000278
Further Details:      
 
Domain Number 3 Region: 637-717
Classification Level Classification E-value
Superfamily Integrin beta tail domain 8.5e-21
Family Integrin beta tail domain 0.000053
Further Details:      
 
Domain Number 4 Region: 28-88
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000628
Family Plexin repeat 0.00024
Further Details:      
 
Domain Number 5 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family Integrin beta EGF-like domains 0.00072
Further Details:      
 
Domain Number 6 Region: 553-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Weak hits

Sequence:  H2UXH3
Domain Number - Region: 519-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2UXH3
Sequence length 789
Comment (tr|H2UXH3|H2UXH3_TAKRU) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101075584 OC=Takifugu.
Sequence
RAQQISYLKLALFYRFICKFLSVLMVSSNICTSRGVTTCQQCLSVHPSCAWCSREVQTDF
GKGSSLSRCDLKENLVKEGCSERDVEFPFSTLTVQEDASLSDKASGAADDVTQVKPQKIH
MTLRQGDAKRFTVYVKQVEDYPVDLYYLMDLSYSMKDDLSRLRTLGNKLAQTMGSTTSKL
RMGFGAFVDKTMSPYMYTHPPGAVENPCLRIQDKCQAQFGFKNVLSLTEQVARFTEEVEK
QQISRNRDAPEGGFDAVMQAVVCKENIGWRRDASHLLVFTTDAKTHLALDGRVAGLVQPN
DGKCHLDNNNNYNQSTILDYPSLALMTEKMSENNINLVLAVTSYVVSLYKEYSQLIPGTT
VGILSDDSGNVIELIQEAYAKIRSKVQMELLGVPDELHLFFNATCQSGEVVPGLKSCSGL
KIGDTVSFSIEAQLRSCPKEKSRTFTIKPLGFKDSLEVTVDFACSCNCEAEAQANSSLCS
NGNGTYECGICQCHPGRRGPRCECSVEDYSPSDDANCIEKADGPVCSGRGDCLCGQCSCH
ANEFGQVWGKYCQCDDFNCLRFRGELCSNHGKCSCGSCVCDAGWKGENCNCSTRTDTCMS
SIGLLCSGRGNCECGVCQCTQPGAYGATCEKCPTCPDSCTIKKHCVECQHFKRGDYIADN
SCSRICKVIRITVFQDNNAVNCSYKDEDDCVVHFQYYEDRSGKSILFVVNKPECPEGPDI
LVVLLAVAGAILLLGLIGLLIWKLLITIHDRREFAKFEEERAKAKWDTGNNPLYKGATST
FTNIAYRGN
Download sequence
Identical sequences H2UXH3
ENSTRUP00000041652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]