SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2UZP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2UZP7
Domain Number 1 Region: 38-164,209-314
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-24
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2UZP7
Sequence length 317
Comment (tr|H2UZP7|H2UZP7_TAKRU) Parvin, gamma {ECO:0000313|Ensembl:ENSTRUP00000042426} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
VDVCDWLHLLWLSREIASPTDNSSNLGDVQKLVQPASLKDPNFEKLKEMLVQWINSTLKP
KHIVVQSLEEDLYDGLVLHHLLSRLAGVHVSVEEIAVSSTAQIHKLEVILEELDKRLGQE
DAGGLKWNVKLIHNKDLLATIHLLVAMVKRFQPELELPPDVKVEVVVVEVSGRGIKSSTE
VEVLTEDRNTSAQPEEDPIDQLLKLEAHKVNTVKQAILHFINQKVSNLGLHVVDMDTQFA
DGVILLLLIGQLEGFFIPLHDFILTPCQSSERLHNMTLAFDLLHDTDLHVASISPQDIVS
QDITATLKILYALFRKH
Download sequence
Identical sequences H2UZP7
31033.ENSTRUP00000042426 ENSTRUP00000042426 ENSTRUP00000042426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]