SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2V2D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2V2D1
Domain Number - Region: 139-168
Classification Level Classification E-value
Superfamily Plexin repeat 0.0331
Family Plexin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2V2D1
Sequence length 323
Comment (tr|H2V2D1|H2V2D1_TAKRU) Palmitoyltransferase {ECO:0000256|RuleBase:RU079119} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=ZDHHC20 OC=Takifugu.
Sequence
MAPHQALRCCKRAINWVPVLFVNLVVGWSYYAYVVELCVYTIQNHAERSKLTVSYLVVFH
AFLMMFLWSYWKTIWSTPASPSQAFSLPRMEKELYEREERAEMQQEILKKVARTLPVYTR
MPDGAIRYCKPCQLIKPDRCHHCSTCERCVLKMDHHCPWVNNCIGFSNYKFFILFLTYAS
LHCLVICATVTQYFIKFWTKKLPDTHAKFHILFLFFVAALFFISIVSLLSYHLWLVGKNR
TTIETFSAAVFTSGRDKSGFSLGCSRNMTEVFGDRAKYWILPVFSGQGDGQSFVTRLVHI
DPEQANSVLQHNAEFRARSVLST
Download sequence
Identical sequences H2V2D1
ENSTRUP00000043362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]