SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2V374 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2V374
Domain Number 1 Region: 360-523
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-45
Family SPRY domain 0.00016
Further Details:      
 
Domain Number 2 Region: 132-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000275
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 8-57
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000169
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2V374
Sequence length 524
Comment (tr|H2V374|H2V374_TAKRU) Si:dkey-29p10.4 {ECO:0000313|Ensembl:ENSTRUP00000043655} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
KMGASLETPARCHLCKVESSEPVTLKCKHRFCRRCIEDLWSTVPNGPYRCPEWRYSFEDT
PAPSASPEVSQKSQSKQFESESKSARPVPCHYCPNAVYQPAIKTCLVCGASMCSEHLRPH
LESPVFQNHTLIAPVEDISSWKCQEHQDINRIYCRKCGVCVCTLCPLVGSHQNHECISLR
EAERELRGNLKKDIAQLQQTEDEVIITLNEVTQKKEASRVVLEKARTSVLQQYAAIREAL
DQEEQTALQCVAKEESRVLGGLEEKLGNLRSSLQSIQKGLHIFEGLADAKGDKHIGDQVF
VRKWTEKRLDTFVITVPGEERDIYIPLCECLNNWLLNRKLACEQCLFIQTSHLCTDGCVP
SLDADTAHPKLQLSDNNREVRYSEAQQPYTEHAARFSSFPQVLASSALQGGRWYWEVNVS
VEEGRWKVGVSEGRIERKGQKDISRLGCNPYSWCLACDKKKVEALHNRVSAPVDADGLQR
VGVFLDFEEGVLSFFNVTPGGSLALVHSYKHSFTDPVYPAFSVS
Download sequence
Identical sequences H2V374
ENSTRUP00000043655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]