SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2V392 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2V392
Domain Number 1 Region: 2-58,92-139
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.61e-20
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 
Domain Number 2 Region: 595-673
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-18
Family DIX domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2V392
Sequence length 678
Comment (tr|H2V392|H2V392_TAKRU) DIX domain containing 1b {ECO:0000313|Ensembl:ENSTRUP00000043673} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
QQLAAYVSWVNSQLKRKPGLKPVRDLRHDLQDGVVLVQLIEIVGKYSIAQKYKFSILYAK
FLFLLCHSLQSFFKSAAGEVLDGVHITPQNKEESRKNVDQVLQFISSRHIRMPHISARDI
VDGNLKSVMRIILALAAHFKPSANHRAASGNVKGSTRGASSHNPRSPIALAQGAAAALAS
ARHDASQPARAACLPRYADAIWGLDMEKSVCVRALVQQYERQSPDEQVQVQSSRSVTPVV
QFSAYWSNLFYLLSSSQSIVYPNKAVKIELRPPSHSKSRDAKTVASLNSLLETGWDDPLS
ETLEKEVEDARKMVSALQALLLHGSLPEDEQDVSLGLDQGEADQQVIVLRSRLDQSMEEA
RELKRELLRCKQEMRNLQGIKDAQQQRLCTQEAAILQMKQELLRASMTKDELVNKNAQLQ
WKMEEYQRLWGDCKKEVEQRDRMLQQLKHKLEENQKTQSTRQQYSIVPPQTRGLKWKLEL
LHHCQLGESCVFVAKISLSTRHNKGLTDVKTDLTEEVQLLRDGLRSLRNNFREHDPQQHT
LDTLEQGIVSLIDRLQVMHRRRGRGKSPRRQTPHADSDSWPCTNVCQPHGGSPASTKILY
FTGKALTPSMISIPKRLGEVTLKDVKAAVDREGSYRYHFKALDPEFGTVKEEVFLDGAII
PGWEGKIVAWLEEDYGEE
Download sequence
Identical sequences H2V392
ENSTRUP00000043673 31033.ENSTRUP00000043673 ENSTRUP00000043673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]