SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2V3U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2V3U5
Domain Number 1 Region: 39-192
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00000000000000432
Family Toll/Interleukin receptor TIR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2V3U5
Sequence length 192
Comment (tr|H2V3U5|H2V3U5_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000043879} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
LSLAVSVGCVVFFMISVVIVYAKFKIYMVLFLRDTLGCHRSSSDGKSYDAFLMCYKSDTD
GGLNEQDKCFLESVLEERFGYSLCLYDRDVLPGNAAPDAVLDSIEQSRTVVLIPTSSDSC
LESGLLIAVHSALVEHRTRLVFIQTNVEQGTCSGSVSEALQLLAEAGDRVTWKGSSSVPL
SSSFWKRLRYYL
Download sequence
Identical sequences H2V3U5
ENSTRUP00000043879 31033.ENSTRUP00000043879 ENSTRUP00000043879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]