SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2V630 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2V630
Domain Number 1 Region: 267-514
Classification Level Classification E-value
Superfamily Caspase-like 4.64e-77
Family Caspase catalytic domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 88-170
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000589
Family DEATH effector domain, DED 0.022
Further Details:      
 
Domain Number 3 Region: 1-78
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000008
Family DEATH effector domain, DED 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2V630
Sequence length 519
Comment (tr|H2V630|H2V630_TAKRU) Caspase 8, apoptosis-related cysteine peptidase, like 2 {ECO:0000313|Ensembl:ENSTRUP00000044664} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
MDFQARLLKVGNDLRKDEVRALVFLCSDILGCNPAAVQSAGDLFSRLSDQDHLSEEQPHL
LVELLGIIQRTKLLRDHNLPRTGAQDLISPYRKLLYSLSEELTADDLKDIKFLLNNKLPR
GKLEEVTTLEVFMELEHRALISDTDLGFLESIIQPVCPVLLEKINQFNAQNCKFYLFTIF
KLQDASDPLKALWLIKKFDSFLVSFSSNESWIGGSVVLFQHPAGKPDLPRSGDVRDRQRR
CSKYENPNPEVLVLSAVGCPDVSVQGVETYLMTAAKRGRCLIINNCNFRVSRLKKREGTM
VDEASLDKVLKWLGFEVEIQRDCTSKKMSSLIQELAKTSQRDWDCVMCCVLSHGLEGGVY
GVDGGTVEIRKLMEPFSGTNCPSLAGKPKIFFIQACQGSRQQDIVYTDAGTPGHGYVDNN
AVQAKECIPSHADFLLGMATVPSFVSFRDGTHGTWYIQSLCQNLADMVPRGCDLISILTK
VNADVSKKVAWIDSGHKTQMPQPAFTLTKKIVFPAPNTP
Download sequence
Identical sequences H2V630
ENSTRUP00000044664 ENSTRUP00000044664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]